BLASTX nr result
ID: Phellodendron21_contig00043850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043850 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006302097.1 hypothetical protein CARUB_v10020088mg, partial [... 71 2e-12 XP_008812598.1 PREDICTED: polygalacturonase At1g48100-like [Phoe... 70 3e-12 KDO82379.1 hypothetical protein CISIN_1g009748mg [Citrus sinensis] 70 6e-12 KDO82378.1 hypothetical protein CISIN_1g009748mg [Citrus sinensis] 70 6e-12 XP_006483884.1 PREDICTED: polygalacturonase At1g48100 [Citrus si... 70 6e-12 XP_006438345.1 hypothetical protein CICLE_v10031220mg [Citrus cl... 70 6e-12 XP_012085406.1 PREDICTED: polygalacturonase At1g48100 isoform X2... 69 8e-12 XP_008444333.1 PREDICTED: polygalacturonase At1g48100-like [Cucu... 69 8e-12 XP_012085405.1 PREDICTED: polygalacturonase At1g48100 isoform X1... 69 8e-12 XP_002525361.1 PREDICTED: polygalacturonase At1g48100 [Ricinus c... 69 8e-12 OMO59178.1 Glycoside hydrolase, family 28 [Corchorus capsularis] 69 1e-11 XP_019171248.1 PREDICTED: polygalacturonase At1g48100-like [Ipom... 69 1e-11 XP_009419849.2 PREDICTED: polygalacturonase At1g48100-like [Musa... 69 2e-11 OAY32571.1 hypothetical protein MANES_13G028600 [Manihot esculenta] 69 2e-11 XP_002311773.1 hypothetical protein POPTR_0008s19350g [Populus t... 69 2e-11 XP_010547772.1 PREDICTED: polygalacturonase At1g48100 [Tarenaya ... 69 2e-11 XP_015957099.1 PREDICTED: polygalacturonase At1g48100-like [Arac... 69 2e-11 XP_016190225.1 PREDICTED: polygalacturonase At1g48100-like [Arac... 69 2e-11 XP_010248489.1 PREDICTED: polygalacturonase At1g48100 [Nelumbo n... 68 2e-11 CDP13178.1 unnamed protein product [Coffea canephora] 68 2e-11 >XP_006302097.1 hypothetical protein CARUB_v10020088mg, partial [Capsella rubella] EOA34995.1 hypothetical protein CARUB_v10020088mg, partial [Capsella rubella] Length = 550 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 QAFEAAWA+ACKVE STM+VPAE +FLVGPISFSGPY Sbjct: 150 QAFEAAWASACKVEASTMIVPAEYIFLVGPISFSGPY 186 >XP_008812598.1 PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera] Length = 480 Score = 70.5 bits (171), Expect = 3e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE STM++PAES FLVGPISFSGPY Sbjct: 103 KAFEAAWAAACKVEASTMVIPAESQFLVGPISFSGPY 139 >KDO82379.1 hypothetical protein CISIN_1g009748mg [Citrus sinensis] Length = 409 Score = 69.7 bits (169), Expect = 6e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE S M+VPAESVFLVGP+SFSGPY Sbjct: 127 KAFEAAWAAACKVEASIMVVPAESVFLVGPMSFSGPY 163 >KDO82378.1 hypothetical protein CISIN_1g009748mg [Citrus sinensis] Length = 527 Score = 69.7 bits (169), Expect = 6e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE S M+VPAESVFLVGP+SFSGPY Sbjct: 127 KAFEAAWAAACKVEASIMVVPAESVFLVGPMSFSGPY 163 >XP_006483884.1 PREDICTED: polygalacturonase At1g48100 [Citrus sinensis] Length = 527 Score = 69.7 bits (169), Expect = 6e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE S M+VPAESVFLVGP+SFSGPY Sbjct: 127 KAFEAAWAAACKVEASIMVVPAESVFLVGPMSFSGPY 163 >XP_006438345.1 hypothetical protein CICLE_v10031220mg [Citrus clementina] ESR51585.1 hypothetical protein CICLE_v10031220mg [Citrus clementina] Length = 527 Score = 69.7 bits (169), Expect = 6e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE S M+VPAESVFLVGP+SFSGPY Sbjct: 127 KAFEAAWAAACKVEASIMVVPAESVFLVGPMSFSGPY 163 >XP_012085406.1 PREDICTED: polygalacturonase At1g48100 isoform X2 [Jatropha curcas] Length = 494 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE STM++PAE VFLVGP+SFSGPY Sbjct: 119 KAFQAAWAAACKVEASTMLIPAEYVFLVGPVSFSGPY 155 >XP_008444333.1 PREDICTED: polygalacturonase At1g48100-like [Cucumis melo] Length = 505 Score = 69.3 bits (168), Expect = 8e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFE AWAAACKVEGST+MVPAE VF VGPISFSGPY Sbjct: 106 KAFEDAWAAACKVEGSTVMVPAEYVFFVGPISFSGPY 142 >XP_012085405.1 PREDICTED: polygalacturonase At1g48100 isoform X1 [Jatropha curcas] KDP26605.1 hypothetical protein JCGZ_17763 [Jatropha curcas] Length = 517 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE STM++PAE VFLVGP+SFSGPY Sbjct: 119 KAFQAAWAAACKVEASTMLIPAEYVFLVGPVSFSGPY 155 >XP_002525361.1 PREDICTED: polygalacturonase At1g48100 [Ricinus communis] EEF36999.1 polygalacturonase, putative [Ricinus communis] Length = 519 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE STM+VPAE +FLVGP+SFSGPY Sbjct: 121 KAFQAAWAAACKVEASTMLVPAEYIFLVGPVSFSGPY 157 >OMO59178.1 Glycoside hydrolase, family 28 [Corchorus capsularis] Length = 422 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGP 149 +AFEAAWAAACKVEGSTM++P+ SVFLVGPISFSGP Sbjct: 36 KAFEAAWAAACKVEGSTMVIPSASVFLVGPISFSGP 71 >XP_019171248.1 PREDICTED: polygalacturonase At1g48100-like [Ipomoea nil] Length = 530 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPYSFK 161 +AF+A WAAACKVE STMMVP+E VFLVGPISFSGPY K Sbjct: 132 KAFQATWAAACKVEASTMMVPSEYVFLVGPISFSGPYCEK 171 >XP_009419849.2 PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. malaccensis] Length = 479 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVEGST++VPAE FLVGPISFSGPY Sbjct: 102 EAFQAAWAAACKVEGSTVVVPAEFEFLVGPISFSGPY 138 >OAY32571.1 hypothetical protein MANES_13G028600 [Manihot esculenta] Length = 515 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF++AWAAACKVE STM+VPAE VFLVGP+SFSGPY Sbjct: 117 KAFQSAWAAACKVEASTMLVPAEFVFLVGPVSFSGPY 153 >XP_002311773.1 hypothetical protein POPTR_0008s19350g [Populus trichocarpa] EEE89140.1 hypothetical protein POPTR_0008s19350g [Populus trichocarpa] Length = 517 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE ST++VPAE VFLVGPISFSGPY Sbjct: 119 KAFQAAWAAACKVEASTLIVPAEYVFLVGPISFSGPY 155 >XP_010547772.1 PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana] Length = 526 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AFEAAWAAACKVE STM+VP E VFLVGPISFSGPY Sbjct: 128 KAFEAAWAAACKVEASTMVVPNEYVFLVGPISFSGPY 164 >XP_015957099.1 PREDICTED: polygalacturonase At1g48100-like [Arachis duranensis] Length = 528 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 27 SCNLMQAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +C+ +AFEAAWAAACKVE STM+VPA+ F VGPISFSGPY Sbjct: 125 NCDDTKAFEAAWAAACKVEASTMVVPADYTFYVGPISFSGPY 166 >XP_016190225.1 PREDICTED: polygalacturonase At1g48100-like [Arachis ipaensis] Length = 538 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 27 SCNLMQAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +C+ +AFEAAWAAACKVE STM+VPA+ F VGPISFSGPY Sbjct: 135 NCDDTKAFEAAWAAACKVEASTMVVPADYTFYVGPISFSGPY 176 >XP_010248489.1 PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera] Length = 526 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE STM+VPA+ VFLVGPISFSGPY Sbjct: 126 KAFQAAWAAACKVEASTMVVPAKLVFLVGPISFSGPY 162 >CDP13178.1 unnamed protein product [Coffea canephora] Length = 531 Score = 68.2 bits (165), Expect = 2e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 42 QAFEAAWAAACKVEGSTMMVPAESVFLVGPISFSGPY 152 +AF+AAWAAACKVE ST++VP++SVFLVGPISFSGPY Sbjct: 133 KAFQAAWAAACKVEASTIVVPSDSVFLVGPISFSGPY 169