BLASTX nr result
ID: Phellodendron21_contig00043823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043823 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU26285.1 Uridine kinase-like protein 1, chloroplastic, partial... 62 8e-10 XP_010556276.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_010528168.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 KZV35011.1 uridine kinase-like protein 1, chloroplastic-like [Do... 62 2e-08 KJB33965.1 hypothetical protein B456_006G041100 [Gossypium raimo... 62 2e-08 KJB11621.1 hypothetical protein B456_001G270100 [Gossypium raimo... 62 2e-08 XP_018435674.1 PREDICTED: uridine kinase-like protein 2, chlorop... 61 2e-08 KJB33963.1 hypothetical protein B456_006G041100 [Gossypium raimo... 62 2e-08 KJB33967.1 hypothetical protein B456_006G041100 [Gossypium raimo... 62 2e-08 KZM97546.1 hypothetical protein DCAR_015092 [Daucus carota subsp... 62 2e-08 EOY02768.1 Uridine kinase/uracil phosphoribosyltransferase 1 iso... 62 2e-08 KJB33964.1 hypothetical protein B456_006G041100 [Gossypium raimo... 62 2e-08 KJB11622.1 hypothetical protein B456_001G270100 [Gossypium raimo... 62 2e-08 OMO92985.1 Uridine kinase [Corchorus olitorius] 62 2e-08 XP_007031841.2 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_016672666.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_016712872.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_016712868.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_012483949.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 XP_012445654.1 PREDICTED: uridine kinase-like protein 1, chlorop... 62 2e-08 >JAU26285.1 Uridine kinase-like protein 1, chloroplastic, partial [Noccaea caerulescens] JAU29169.1 Uridine kinase-like protein 1, chloroplastic, partial [Noccaea caerulescens] JAU57131.1 Uridine kinase-like protein 1, chloroplastic, partial [Noccaea caerulescens] JAU81438.1 Uridine kinase-like protein 1, chloroplastic, partial [Noccaea caerulescens] Length = 93 Score = 61.6 bits (148), Expect = 8e-10 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 18 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 51 >XP_010556276.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Tarenaya hassleriana] Length = 483 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 212 VSSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 245 >XP_010528168.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Tarenaya hassleriana] Length = 483 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 212 VSSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 245 >KZV35011.1 uridine kinase-like protein 1, chloroplastic-like [Dorcoceras hygrometricum] Length = 505 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 96 MSILQYAKFVKPAFDDFVLPSKKYADVIIPRG 1 M +QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 236 MLSVQYAKFVKPAFDDFVLPSKKYADVIIPRG 267 >KJB33965.1 hypothetical protein B456_006G041100 [Gossypium raimondii] Length = 301 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 30 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 63 >KJB11621.1 hypothetical protein B456_001G270100 [Gossypium raimondii] Length = 335 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_018435674.1 PREDICTED: uridine kinase-like protein 2, chloroplastic, partial [Raphanus sativus] Length = 275 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 218 QYAKFVKPAFDDFVLPSKKYADVIIPRG 245 >KJB33963.1 hypothetical protein B456_006G041100 [Gossypium raimondii] Length = 395 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >KJB33967.1 hypothetical protein B456_006G041100 [Gossypium raimondii] Length = 403 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 132 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 165 >KZM97546.1 hypothetical protein DCAR_015092 [Daucus carota subsp. sativus] Length = 409 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 93 SILQYAKFVKPAFDDFVLPSKKYADVIIPRG 1 S QYAKFVKPAFDDF+LPSKKYADVIIPRG Sbjct: 141 SFRQYAKFVKPAFDDFILPSKKYADVIIPRG 171 >EOY02768.1 Uridine kinase/uracil phosphoribosyltransferase 1 isoform 2, partial [Theobroma cacao] Length = 435 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 226 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 259 >KJB33964.1 hypothetical protein B456_006G041100 [Gossypium raimondii] Length = 438 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >KJB11622.1 hypothetical protein B456_001G270100 [Gossypium raimondii] Length = 463 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 192 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 225 >OMO92985.1 Uridine kinase [Corchorus olitorius] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_007031841.2 PREDICTED: uridine kinase-like protein 1, chloroplastic [Theobroma cacao] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_016672666.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Gossypium hirsutum] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_016712872.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Gossypium hirsutum] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_016712868.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Gossypium hirsutum] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_012483949.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Gossypium raimondii] KJB33962.1 hypothetical protein B456_006G041100 [Gossypium raimondii] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228 >XP_012445654.1 PREDICTED: uridine kinase-like protein 1, chloroplastic [Gossypium raimondii] KJB11623.1 hypothetical protein B456_001G270100 [Gossypium raimondii] Length = 466 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 99 VMSIL-QYAKFVKPAFDDFVLPSKKYADVIIPRG 1 V S+L QYAKFVKPAFDDFVLPSKKYADVIIPRG Sbjct: 195 VNSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRG 228