BLASTX nr result
ID: Phellodendron21_contig00043768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043768 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EER39955.1 ribosomal protein S13p/S18e [Histoplasma capsulatum H... 60 7e-10 CCG83472.1 Ribosomal protein S13p/S18e [Taphrina deformans PYCC ... 62 1e-09 KZS03964.1 40S ribosomal protein S18 [Daphnia magna] 60 1e-09 XP_018063211.1 30S ribosomal protein S13p/S18e, partial [Phialoc... 60 2e-09 CRK40271.1 hypothetical protein BN1708_016786, partial [Verticil... 60 2e-09 EGE09545.1 30S ribosomal protein S13p/S18e [Trichophyton equinum... 60 2e-09 ODN04753.1 40S ribosomal protein S18 [Orchesella cincta] 61 2e-09 OJD22364.1 40S ribosomal protein S18 [Blastomyces sp. CAC-2015b] 60 2e-09 XP_018295830.1 hypothetical protein PHYBLDRAFT_36600 [Phycomyces... 61 3e-09 CAJ17223.1 ribosomal protein S18e, partial [Eucinetus sp. APV-2005] 59 3e-09 ABW04142.1 ribosomal protein S18, partial [Epinephelus coioides] 59 3e-09 ADP21466.1 ribosomal protein S18, partial [Antheraea yamamai] 59 3e-09 AGC74031.1 ribosomal protein S18 [Spirometra erinaceieuropaei] 61 4e-09 P49202.1 RecName: Full=40S ribosomal protein S18 CAA58668.1 ribo... 61 4e-09 XP_007289121.1 40S ribosomal protein S18 [Marssonina brunnea f. ... 60 4e-09 ODH49935.1 40S ribosomal protein S18 [Paracoccidioides brasilien... 60 4e-09 XP_015765962.1 PREDICTED: 40S ribosomal protein S18 [Acropora di... 60 4e-09 KXN90913.1 40S ribosomal protein S18 [Leucoagaricus sp. SymC.cos] 60 4e-09 KNZ80444.1 40S ribosomal protein S18 [Termitomyces sp. J132] 60 4e-09 KLJ11699.1 40S ribosomal protein S18 [Emmonsia parva UAMH 139] 60 4e-09 >EER39955.1 ribosomal protein S13p/S18e [Histoplasma capsulatum H143] Length = 51 Score = 60.1 bits (144), Expect = 7e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 8 DLERLKKIRAHRGLRHYWGLRVRGQH 33 >CCG83472.1 Ribosomal protein S13p/S18e [Taphrina deformans PYCC 5710] Length = 156 Score = 62.0 bits (149), Expect = 1e-09 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 38 TTMIPDLERLKKIRAHRGLRHYWGLRVRGQH 130 T M DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 109 TKMRDDLERLKKIRAHRGLRHYWGLRVRGQH 139 >KZS03964.1 40S ribosomal protein S18 [Daphnia magna] Length = 82 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 40 DLERLKKIRAHRGLRHYWGLRVRGQH 65 >XP_018063211.1 30S ribosomal protein S13p/S18e, partial [Phialocephala scopiformis] KUJ08856.1 30S ribosomal protein S13p/S18e, partial [Phialocephala scopiformis] Length = 99 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 55 DLERLKKIRAHRGLRHYWGLRVRGQH 80 >CRK40271.1 hypothetical protein BN1708_016786, partial [Verticillium longisporum] Length = 100 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 56 DLERLKKIRAHRGLRHYWGLRVRGQH 81 >EGE09545.1 30S ribosomal protein S13p/S18e [Trichophyton equinum CBS 127.97] Length = 103 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 60 DLERLKKIRAHRGLRHYWGLRVRGQH 85 >ODN04753.1 40S ribosomal protein S18 [Orchesella cincta] Length = 152 Score = 61.2 bits (147), Expect = 2e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 35 KTTMIPDLERLKKIRAHRGLRHYWGLRVRGQH 130 +T + DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 104 ETKLREDLERLKKIRAHRGLRHYWGLRVRGQH 135 >OJD22364.1 40S ribosomal protein S18 [Blastomyces sp. CAC-2015b] Length = 105 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 62 DLERLKKIRAHRGLRHYWGLRVRGQH 87 >XP_018295830.1 hypothetical protein PHYBLDRAFT_36600 [Phycomyces blakesleeanus NRRL 1555(-)] XP_018292808.1 hypothetical protein PHYBLDRAFT_36696 [Phycomyces blakesleeanus NRRL 1555(-)] OAD74768.1 hypothetical protein PHYBLDRAFT_36696 [Phycomyces blakesleeanus NRRL 1555(-)] OAD77790.1 hypothetical protein PHYBLDRAFT_36600 [Phycomyces blakesleeanus NRRL 1555(-)] Length = 154 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 29 VSKTTMIPDLERLKKIRAHRGLRHYWGLRVRGQH 130 V T + DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 104 VLDTKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 137 >CAJ17223.1 ribosomal protein S18e, partial [Eucinetus sp. APV-2005] Length = 49 Score = 58.5 bits (140), Expect = 3e-09 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLER+KKIRAHRG+RHYWGLRVRGQH Sbjct: 7 DLERMKKIRAHRGMRHYWGLRVRGQH 32 >ABW04142.1 ribosomal protein S18, partial [Epinephelus coioides] Length = 50 Score = 58.5 bits (140), Expect = 3e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRH+WGLRVRGQH Sbjct: 8 DLERLKKIRAHRGLRHFWGLRVRGQH 33 >ADP21466.1 ribosomal protein S18, partial [Antheraea yamamai] Length = 82 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRG+RHYWGLRVRGQH Sbjct: 40 DLERLKKIRAHRGMRHYWGLRVRGQH 65 >AGC74031.1 ribosomal protein S18 [Spirometra erinaceieuropaei] Length = 153 Score = 60.8 bits (146), Expect = 4e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 38 TTMIPDLERLKKIRAHRGLRHYWGLRVRGQH 130 T + DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 106 TKLREDLERLKKIRAHRGLRHYWGLRVRGQH 136 >P49202.1 RecName: Full=40S ribosomal protein S18 CAA58668.1 ribosomal protein S18 [Chlamydomonas reinhardtii] prf||2205351A ribosomal protein S18 Length = 153 Score = 60.8 bits (146), Expect = 4e-09 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 38 TTMIPDLERLKKIRAHRGLRHYWGLRVRGQH 130 T M DLERLKKIR HRGLRHYWGLRVRGQH Sbjct: 106 TVMRDDLERLKKIRGHRGLRHYWGLRVRGQH 136 >XP_007289121.1 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] EKD20550.1 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 123 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 79 DLERLKKIRAHRGLRHYWGLRVRGQH 104 >ODH49935.1 40S ribosomal protein S18 [Paracoccidioides brasiliensis] Length = 127 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 84 DLERLKKIRAHRGLRHYWGLRVRGQH 109 >XP_015765962.1 PREDICTED: 40S ribosomal protein S18 [Acropora digitifera] Length = 127 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 84 DLERLKKIRAHRGLRHYWGLRVRGQH 109 >KXN90913.1 40S ribosomal protein S18 [Leucoagaricus sp. SymC.cos] Length = 127 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 84 DLERLKKIRAHRGLRHYWGLRVRGQH 109 >KNZ80444.1 40S ribosomal protein S18 [Termitomyces sp. J132] Length = 127 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 84 DLERLKKIRAHRGLRHYWGLRVRGQH 109 >KLJ11699.1 40S ribosomal protein S18 [Emmonsia parva UAMH 139] Length = 127 Score = 60.1 bits (144), Expect = 4e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 53 DLERLKKIRAHRGLRHYWGLRVRGQH 130 DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 84 DLERLKKIRAHRGLRHYWGLRVRGQH 109