BLASTX nr result
ID: Phellodendron21_contig00043753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043753 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPQ66151.1 Protein component of the large (60S) ribosomal subuni... 107 7e-28 CCU81794.1 60S ribosomal protein L44 [Blumeria graminis f. sp. h... 107 1e-27 XP_001554544.1 60S ribosomal protein L42 [Botrytis cinerea B05.1... 107 1e-27 KIN06482.1 hypothetical protein OIDMADRAFT_17338 [Oidiodendron m... 107 1e-27 XP_007783277.1 60S ribosomal protein L44 [Coniosporium apollinis... 107 2e-27 CZT44979.1 probable 60S ribosomal protein L44 [Rhynchosporium se... 107 2e-27 EPQ62267.1 Protein component of the large (60S) ribosomal subuni... 107 3e-27 CCU82885.1 60S ribosomal protein L44 [Blumeria graminis f. sp. h... 107 3e-27 OCT49343.1 60S ribosomal protein L44 [Cladophialophora carrionii] 105 3e-27 XP_018066185.1 putative 60S ribosomal protein L44 [Phialocephala... 105 3e-27 XP_013311583.1 60S ribosomal protein L44 [Exophiala xenobiotica]... 105 3e-27 CZS90291.1 probable 60S ribosomal protein L44 [Rhynchosporium ag... 107 4e-27 XP_008725835.1 60S ribosomal protein L44 [Cladophialophora carri... 105 4e-27 KUL90063.1 hypothetical protein ZTR_02842 [Talaromyces verruculo... 105 4e-27 XP_020120612.1 60S ribosomal protein L44 [Talaromyces atroroseus... 105 4e-27 KKY28554.1 putative 60s ribosomal protein l44 [Phaeomoniella chl... 105 4e-27 XP_002478798.1 60S ribosomal protein L42 [Talaromyces stipitatus... 105 4e-27 XP_002146499.1 60S ribosomal protein L42 [Talaromyces marneffei ... 105 4e-27 XP_007928037.1 hypothetical protein MYCFIDRAFT_58945 [Pseudocerc... 105 4e-27 XP_003851584.1 60S ribosomal protein L42 [Zymoseptoria tritici I... 105 4e-27 >EPQ66151.1 Protein component of the large (60S) ribosomal subunit, partial [Blumeria graminis f. sp. tritici 96224] Length = 94 Score = 107 bits (266), Expect = 7e-28 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 44 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 94 >CCU81794.1 60S ribosomal protein L44 [Blumeria graminis f. sp. hordei DH14] Length = 104 Score = 107 bits (266), Expect = 1e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 54 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 104 >XP_001554544.1 60S ribosomal protein L42 [Botrytis cinerea B05.10] XP_001593955.1 60S ribosomal protein L42 [Sclerotinia sclerotiorum 1980 UF-70] EDO02906.1 60S ribosomal protein L44 [Sclerotinia sclerotiorum 1980 UF-70] CCD44468.1 similar to 60S ribosomal protein L44 [Botrytis cinerea T4] EHL03476.1 putative 60S ribosomal protein L44 [Glarea lozoyensis 74030] EMR87511.1 putative 60s ribosomal protein l44 protein [Botrytis cinerea BcDW1] APA11866.1 hypothetical protein sscle_08g066360 [Sclerotinia sclerotiorum 1980 UF-70] CZR59862.1 60S ribosomal protein L44 [Phialocephala subalpina] Length = 106 Score = 107 bits (266), Expect = 1e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >KIN06482.1 hypothetical protein OIDMADRAFT_17338 [Oidiodendron maius Zn] Length = 106 Score = 107 bits (266), Expect = 1e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_007783277.1 60S ribosomal protein L44 [Coniosporium apollinis CBS 100218] EON67960.1 60S ribosomal protein L44 [Coniosporium apollinis CBS 100218] Length = 131 Score = 107 bits (266), Expect = 2e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 81 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 131 >CZT44979.1 probable 60S ribosomal protein L44 [Rhynchosporium secalis] Length = 135 Score = 107 bits (266), Expect = 2e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 85 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 135 >EPQ62267.1 Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 137 Score = 107 bits (266), Expect = 3e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 87 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 137 >CCU82885.1 60S ribosomal protein L44 [Blumeria graminis f. sp. hordei DH14] Length = 138 Score = 107 bits (266), Expect = 3e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 88 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 138 >OCT49343.1 60S ribosomal protein L44 [Cladophialophora carrionii] Length = 106 Score = 105 bits (263), Expect = 3e-27 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQL+LKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTSCKTKAQLSLKRCKHFELGGDKKTKGAALVF 106 >XP_018066185.1 putative 60S ribosomal protein L44 [Phialocephala scopiformis] KUJ11830.1 putative 60S ribosomal protein L44 [Phialocephala scopiformis] Length = 106 Score = 105 bits (263), Expect = 3e-27 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT+CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_013311583.1 60S ribosomal protein L44 [Exophiala xenobiotica] KIW50999.1 60S ribosomal protein L44 [Exophiala xenobiotica] Length = 106 Score = 105 bits (263), Expect = 3e-27 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT+CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >CZS90291.1 probable 60S ribosomal protein L44 [Rhynchosporium agropyri] Length = 150 Score = 107 bits (266), Expect = 4e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 100 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 150 >XP_008725835.1 60S ribosomal protein L44 [Cladophialophora carrionii CBS 160.54] ETI26490.1 60S ribosomal protein L44 [Cladophialophora carrionii CBS 160.54] Length = 114 Score = 105 bits (263), Expect = 4e-27 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECTSCKTKAQL+LKRCKHFELGGDKKTKGAALVF Sbjct: 64 PVFHKKAKTTKKVVLRLECTSCKTKAQLSLKRCKHFELGGDKKTKGAALVF 114 >KUL90063.1 hypothetical protein ZTR_02842 [Talaromyces verruculosus] Length = 105 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 55 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 105 >XP_020120612.1 60S ribosomal protein L44 [Talaromyces atroroseus] OKL60491.1 60S ribosomal protein L44 [Talaromyces atroroseus] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >KKY28554.1 putative 60s ribosomal protein l44 [Phaeomoniella chlamydospora] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_002478798.1 60S ribosomal protein L42 [Talaromyces stipitatus ATCC 10500] EED21835.1 60S ribosomal protein L44 [Talaromyces stipitatus ATCC 10500] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_002146499.1 60S ribosomal protein L42 [Talaromyces marneffei ATCC 18224] EEA25952.1 60S ribosomal protein L44 [Talaromyces marneffei ATCC 18224] KFX47448.1 60S ribosomal protein L44 [Talaromyces marneffei PM1] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_007928037.1 hypothetical protein MYCFIDRAFT_58945 [Pseudocercospora fijiensis CIRAD86] EME81483.1 hypothetical protein MYCFIDRAFT_58945 [Pseudocercospora fijiensis CIRAD86] KXT00594.1 hypothetical protein AC578_3153 [Mycosphaerella eumusae] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106 >XP_003851584.1 60S ribosomal protein L42 [Zymoseptoria tritici IPO323] XP_016760574.1 Ribosomal_L44-domain-containing protein [Sphaerulina musiva SO2202] EGP86560.1 hypothetical protein MYCGRDRAFT_73399 [Zymoseptoria tritici IPO323] EMF12453.1 Ribosomal_L44-domain-containing protein [Sphaerulina musiva SO2202] GAM85839.1 hypothetical protein ANO11243_038470 [fungal sp. No.11243] Length = 106 Score = 105 bits (262), Expect = 4e-27 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -3 Query: 379 PVFHKKAKTTKKVVLRLECTSCKTKAQLALKRCKHFELGGDKKTKGAALVF 227 PVFHKKAKTTKKVVLRLECT CKTKAQLALKRCKHFELGGDKKTKGAALVF Sbjct: 56 PVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF 106