BLASTX nr result
ID: Phellodendron21_contig00043745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043745 (545 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ70704.1 hypothetical protein ZOSMA_196G00540 [Zostera marina] 62 8e-09 EYU31144.1 hypothetical protein MIMGU_mgv11b0158821mg, partial [... 59 3e-08 CAN81059.1 hypothetical protein VITISV_017269 [Vitis vinifera] 59 2e-07 XP_006425548.1 hypothetical protein CICLE_v10025760mg [Citrus cl... 60 2e-07 KDO71103.1 hypothetical protein CISIN_1g0155242mg [Citrus sinens... 59 3e-07 KJB17689.1 hypothetical protein B456_003G011300 [Gossypium raimo... 59 3e-07 XP_012469367.1 PREDICTED: UPF0183 protein At3g51130 isoform X4 [... 59 3e-07 EEF30859.1 conserved hypothetical protein [Ricinus communis] 59 3e-07 XP_006383136.1 hypothetical protein POPTR_0005s11910g [Populus t... 59 3e-07 XP_015582299.1 PREDICTED: LOW QUALITY PROTEIN: UPF0183 protein A... 59 3e-07 XP_012469366.1 PREDICTED: UPF0183 protein At3g51130 isoform X3 [... 59 3e-07 KJB17691.1 hypothetical protein B456_003G011300 [Gossypium raimo... 59 3e-07 XP_010649077.1 PREDICTED: UPF0183 protein At3g51130 isoform X2 [... 59 3e-07 XP_006425550.1 hypothetical protein CICLE_v10025760mg [Citrus cl... 59 3e-07 CBI17410.3 unnamed protein product, partial [Vitis vinifera] 59 4e-07 XP_020113432.1 UPF0183 protein At3g51130 isoform X2 [Ananas como... 59 4e-07 CDP01932.1 unnamed protein product [Coffea canephora] 59 4e-07 XP_020113431.1 UPF0183 protein At3g51130 isoform X1 [Ananas como... 59 4e-07 KYP66891.1 UPF0183 protein At3g51130 family [Cajanus cajan] 59 4e-07 XP_014631273.1 PREDICTED: UPF0183 protein At3g51130 isoform X3 [... 59 4e-07 >KMZ70704.1 hypothetical protein ZOSMA_196G00540 [Zostera marina] Length = 151 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 316 HCFM*EPLKLDIVISFPDHGFHLRFDPWSQ 227 +C+ EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 84 NCYDEEPLKLDIVISFPDHGFHLRFDPWSQ 113 >EYU31144.1 hypothetical protein MIMGU_mgv11b0158821mg, partial [Erythranthe guttata] Length = 110 Score = 58.9 bits (141), Expect = 3e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLD+VISFPDHGFHLRFDPWSQ Sbjct: 28 EPLKLDVVISFPDHGFHLRFDPWSQ 52 >CAN81059.1 hypothetical protein VITISV_017269 [Vitis vinifera] Length = 220 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 61 EPLKLDIVISFPDHGFHLRFDPWSQ 85 >XP_006425548.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] XP_006425549.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] ESR38788.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] ESR38789.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] Length = 344 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 307 M*EPLKLDIVISFPDHGFHLRFDPWSQ 227 M EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 1 MQEPLKLDIVISFPDHGFHLRFDPWSQ 27 >KDO71103.1 hypothetical protein CISIN_1g0155242mg [Citrus sinensis] KDO71104.1 hypothetical protein CISIN_1g0155242mg [Citrus sinensis] Length = 344 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 307 M*EPLKLDIVISFPDHGFHLRFDPWSQ 227 M EPLKLDI+ISFPDHGFHLRFDPWSQ Sbjct: 1 MQEPLKLDIIISFPDHGFHLRFDPWSQ 27 >KJB17689.1 hypothetical protein B456_003G011300 [Gossypium raimondii] Length = 352 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 61 EPLKLDIVISFPDHGFHLRFDPWSQ 85 >XP_012469367.1 PREDICTED: UPF0183 protein At3g51130 isoform X4 [Gossypium raimondii] Length = 355 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 61 EPLKLDIVISFPDHGFHLRFDPWSQ 85 >EEF30859.1 conserved hypothetical protein [Ricinus communis] Length = 357 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 65 EPLKLDIVISFPDHGFHLRFDPWSQ 89 >XP_006383136.1 hypothetical protein POPTR_0005s11910g [Populus trichocarpa] ERP60933.1 hypothetical protein POPTR_0005s11910g [Populus trichocarpa] Length = 357 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 70 EPLKLDIVISFPDHGFHLRFDPWSQ 94 >XP_015582299.1 PREDICTED: LOW QUALITY PROTEIN: UPF0183 protein At3g51130 [Ricinus communis] Length = 360 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 65 EPLKLDIVISFPDHGFHLRFDPWSQ 89 >XP_012469366.1 PREDICTED: UPF0183 protein At3g51130 isoform X3 [Gossypium raimondii] Length = 361 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 61 EPLKLDIVISFPDHGFHLRFDPWSQ 85 >KJB17691.1 hypothetical protein B456_003G011300 [Gossypium raimondii] Length = 361 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 61 EPLKLDIVISFPDHGFHLRFDPWSQ 85 >XP_010649077.1 PREDICTED: UPF0183 protein At3g51130 isoform X2 [Vitis vinifera] Length = 369 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 28 EPLKLDIVISFPDHGFHLRFDPWSQ 52 >XP_006425550.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] ESR38790.1 hypothetical protein CICLE_v10025760mg [Citrus clementina] Length = 369 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 28 EPLKLDIVISFPDHGFHLRFDPWSQ 52 >CBI17410.3 unnamed protein product, partial [Vitis vinifera] Length = 389 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72 >XP_020113432.1 UPF0183 protein At3g51130 isoform X2 [Ananas comosus] Length = 390 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72 >CDP01932.1 unnamed protein product [Coffea canephora] Length = 390 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72 >XP_020113431.1 UPF0183 protein At3g51130 isoform X1 [Ananas comosus] Length = 391 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72 >KYP66891.1 UPF0183 protein At3g51130 family [Cajanus cajan] Length = 391 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72 >XP_014631273.1 PREDICTED: UPF0183 protein At3g51130 isoform X3 [Glycine max] Length = 391 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 301 EPLKLDIVISFPDHGFHLRFDPWSQ 227 EPLKLDIVISFPDHGFHLRFDPWSQ Sbjct: 48 EPLKLDIVISFPDHGFHLRFDPWSQ 72