BLASTX nr result
ID: Phellodendron21_contig00043738
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043738 (460 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006440564.1 hypothetical protein CICLE_v10023056mg [Citrus cl... 59 2e-08 >XP_006440564.1 hypothetical protein CICLE_v10023056mg [Citrus clementina] ESR53804.1 hypothetical protein CICLE_v10023056mg [Citrus clementina] Length = 94 Score = 58.5 bits (140), Expect = 2e-08 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%) Frame = +3 Query: 180 FHILPTFNFKLRFLEKSEIPTCSRMT*---IIVPGPNGHTQRFLCRCGNNFGSLALTYSH 350 F L T NFK+ K + + + I+VPG N QR+LCR GNNFG LAL Y H Sbjct: 7 FSYLATTNFKVFLKNKKKKFRNTNLLYNEWIMVPGTNEQAQRYLCRYGNNFGCLALNYRH 66 Query: 351 VWLWILS 371 +W WIL+ Sbjct: 67 LWPWILN 73