BLASTX nr result
ID: Phellodendron21_contig00043693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043693 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI35712.3 unnamed protein product, partial [Vitis vinifera] 55 2e-06 >CBI35712.3 unnamed protein product, partial [Vitis vinifera] Length = 412 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -3 Query: 292 MLGYMSH*ATHGRDNHRFYVQRRASTSISWISFVFNQQQLSLVDL 158 MLGYMSH ATHGR + R+YVQ + ISWI F FN+Q L +L Sbjct: 63 MLGYMSHCATHGRGHRRYYVQPGTNAPISWILFAFNRQLLPFGEL 107