BLASTX nr result
ID: Phellodendron21_contig00043627
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043627 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006447000.1 hypothetical protein CICLE_v10017811mg, partial [... 87 3e-18 >XP_006447000.1 hypothetical protein CICLE_v10017811mg, partial [Citrus clementina] ESR60240.1 hypothetical protein CICLE_v10017811mg, partial [Citrus clementina] Length = 450 Score = 86.7 bits (213), Expect = 3e-18 Identities = 50/76 (65%), Positives = 52/76 (68%) Frame = +2 Query: 2 KGYQQAEVIVLELFGIAVLLFMCKTSIVMLTTLELVW*NWLVIIYYNKLAYIFSDLLLQT 181 KGYQQAEVIVL+L GIAVLLF CK L NK+AYIF DLLLQT Sbjct: 238 KGYQQAEVIVLDLLGIAVLLFACKLGYFNLD---------------NKVAYIFGDLLLQT 282 Query: 182 EVLKQLSSMGRLVVCA 229 EVLKQLSSMGRLVVCA Sbjct: 283 EVLKQLSSMGRLVVCA 298