BLASTX nr result
ID: Phellodendron21_contig00043605
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043605 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO75782.1 hypothetical protein CISIN_1g022813mg [Citrus sinensis] 63 3e-09 XP_006449244.1 hypothetical protein CICLE_v10016137mg [Citrus cl... 63 3e-09 >KDO75782.1 hypothetical protein CISIN_1g022813mg [Citrus sinensis] Length = 245 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = -3 Query: 297 DGWSNDISSQENCAS---VCPNG*LHAIQFPLNVCMDSSG 187 DGWSND+SS ENCA+ VCPNG H+IQFPL+ C+DSSG Sbjct: 206 DGWSNDVSSWENCANNQTVCPNGYAHSIQFPLHCCVDSSG 245 >XP_006449244.1 hypothetical protein CICLE_v10016137mg [Citrus clementina] ESR62484.1 hypothetical protein CICLE_v10016137mg [Citrus clementina] Length = 245 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = -3 Query: 297 DGWSNDISSQENCAS---VCPNG*LHAIQFPLNVCMDSSG 187 DGWSND+SS ENCA+ VCPNG H+IQFPL+ C+DSSG Sbjct: 206 DGWSNDVSSWENCANNQTVCPNGYAHSIQFPLHCCVDSSG 245