BLASTX nr result
ID: Phellodendron21_contig00043588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043588 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCG82878.1 Putative uncharacterized protein [Taphrina deformans ... 67 8e-12 KPM43248.1 hypothetical protein AK830_g3321 [Neonectria ditissima] 65 3e-11 XP_008098287.1 hypothetical protein GLRG_09411 [Colletotrichum g... 64 6e-11 OGE56924.1 hypothetical protein PENARI_c002G06315 [Penicillium a... 64 9e-11 KKA30488.1 hypothetical protein TD95_000653 [Thielaviopsis punct... 64 1e-10 XP_008080095.1 hypothetical protein GLAREA_06491 [Glarea lozoyen... 64 1e-10 XP_007283356.1 cipC-like antibiotic response protein [Colletotri... 63 2e-10 OHF01731.1 hypothetical protein CORC01_02922 [Colletotrichum orc... 63 2e-10 KXH68414.1 hypothetical protein CSAL01_00287 [Colletotrichum sal... 63 2e-10 XP_007594986.1 hypothetical protein CFIO01_01023 [Colletotrichum... 63 2e-10 CCF40203.1 hypothetical protein CH063_10835 [Colletotrichum higg... 63 2e-10 XP_009653983.1 CipC protein [Verticillium dahliae VdLs.17] EGY19... 63 2e-10 XP_018160131.1 putative CipC-like antibiotic response protein [C... 63 3e-10 ENH82634.1 CipC-like antibiotic response protein, putative [Coll... 62 3e-10 KZT64171.1 putative CipC-like antibiotic response protein, parti... 62 4e-10 OHW89794.1 cipc-like antibiotic response protein, partial [Colle... 62 4e-10 KZL87511.1 cipc-like antibiotic response protein [Colletotrichum... 62 4e-10 CRK28579.1 hypothetical protein BN1708_015254 [Verticillium long... 63 5e-10 EPT00272.1 hypothetical protein FOMPIDRAFT_1049855 [Fomitopsis p... 64 5e-10 CRK26369.1 hypothetical protein BN1708_018238, partial [Verticil... 62 6e-10 >CCG82878.1 Putative uncharacterized protein [Taphrina deformans PYCC 5710] Length = 123 Score = 66.6 bits (161), Expect = 8e-12 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 + V+HGF KE+LAG+A GEVDKL ETKGLDY+DREKAKR Sbjct: 50 QPVSHGFAKELLAGIAGGEVDKLFETKGLDYLDREKAKR 88 >KPM43248.1 hypothetical protein AK830_g3321 [Neonectria ditissima] Length = 121 Score = 65.1 bits (157), Expect = 3e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAK 114 E VNHGF KE+LAG AA EVDKLAETKGLD+IDREK K Sbjct: 50 EPVNHGFAKEILAGFAAAEVDKLAETKGLDFIDREKTK 87 >XP_008098287.1 hypothetical protein GLRG_09411 [Colletotrichum graminicola M1.001] EFQ34267.1 hypothetical protein GLRG_09411 [Colletotrichum graminicola M1.001] Length = 123 Score = 64.3 bits (155), Expect = 6e-11 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KE+LAG+A EVDKL ETKGLDYIDREKAKR Sbjct: 52 EPVKHAFAKELLAGIAGAEVDKLVETKGLDYIDREKAKR 90 >OGE56924.1 hypothetical protein PENARI_c002G06315 [Penicillium arizonense] Length = 109 Score = 63.5 bits (153), Expect = 9e-11 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 +EVNH F KE+L G GE+DKLAETKG+D++DREKAKR Sbjct: 52 QEVNHAFAKELLVGFVGGEIDKLAETKGMDWVDREKAKR 90 >KKA30488.1 hypothetical protein TD95_000653 [Thielaviopsis punctulata] Length = 119 Score = 63.5 bits (153), Expect = 1e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAK 114 E VNHGF KE+LAG+A EVDKL ETKGLD+IDREKAK Sbjct: 48 ETVNHGFAKEVLAGLAGAEVDKLFETKGLDFIDREKAK 85 >XP_008080095.1 hypothetical protein GLAREA_06491 [Glarea lozoyensis ATCC 20868] EHK97954.1 hypothetical protein M7I_6295 [Glarea lozoyensis 74030] EPE33478.1 hypothetical protein GLAREA_06491 [Glarea lozoyensis ATCC 20868] Length = 128 Score = 63.5 bits (153), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 7 VNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 V+H F KE+LAG+A EVDKLAETKGLDY+DREKAKR Sbjct: 55 VSHQFAKELLAGIAGAEVDKLAETKGLDYVDREKAKR 91 >XP_007283356.1 cipC-like antibiotic response protein [Colletotrichum gloeosporioides Nara gc5] ELA27578.1 cipC-like antibiotic response protein [Colletotrichum gloeosporioides Nara gc5] EQB53960.1 hypothetical protein CGLO_06265 [Colletotrichum gloeosporioides Cg-14] Length = 119 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEMLAG+A EVDKL ETKGLDY+DREKAKR Sbjct: 48 EPVKHQFAKEMLAGIAGAEVDKLFETKGLDYLDREKAKR 86 >OHF01731.1 hypothetical protein CORC01_02922 [Colletotrichum orchidophilum] Length = 120 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEM+AG+A EVDKL ETKGLDYIDREKAKR Sbjct: 49 EPVKHQFAKEMIAGIAGAEVDKLFETKGLDYIDREKAKR 87 >KXH68414.1 hypothetical protein CSAL01_00287 [Colletotrichum salicis] Length = 120 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEM+AG+A EVDKL ETKGLDYIDREKAKR Sbjct: 49 EPVKHQFAKEMIAGIAGAEVDKLFETKGLDYIDREKAKR 87 >XP_007594986.1 hypothetical protein CFIO01_01023 [Colletotrichum fioriniae PJ7] EXF81361.1 hypothetical protein CFIO01_01023 [Colletotrichum fioriniae PJ7] KXH47845.1 hypothetical protein CNYM01_01363 [Colletotrichum nymphaeae SA-01] KXH49788.1 hypothetical protein CSIM01_03925 [Colletotrichum simmondsii] Length = 120 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEM+AG+A EVDKL ETKGLDYIDREKAKR Sbjct: 49 EPVKHQFAKEMIAGIAGAEVDKLFETKGLDYIDREKAKR 87 >CCF40203.1 hypothetical protein CH063_10835 [Colletotrichum higginsianum] Length = 120 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEML G+A EVDKL ETKGLDYIDREKAKR Sbjct: 49 EPVKHAFAKEMLVGIAGAEVDKLFETKGLDYIDREKAKR 87 >XP_009653983.1 CipC protein [Verticillium dahliae VdLs.17] EGY19052.1 CipC protein [Verticillium dahliae VdLs.17] Length = 129 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V+H F KE+LAG A EVDKL ETKGLDYIDREKAKR Sbjct: 6 EPVHHAFAKELLAGFAGAEVDKLVETKGLDYIDREKAKR 44 >XP_018160131.1 putative CipC-like antibiotic response protein [Colletotrichum higginsianum IMI 349063] OBR11614.1 putative CipC-like antibiotic response protein [Colletotrichum higginsianum IMI 349063] Length = 144 Score = 63.2 bits (152), Expect = 3e-10 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEML G+A EVDKL ETKGLDYIDREKAKR Sbjct: 73 EPVKHAFAKEMLVGIAGAEVDKLFETKGLDYIDREKAKR 111 >ENH82634.1 CipC-like antibiotic response protein, putative [Colletotrichum orbiculare MAFF 240422] Length = 119 Score = 62.4 bits (150), Expect = 3e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KEML G+A EVDKL ETKGLDY+DREKAKR Sbjct: 48 EPVKHAFAKEMLVGIAGAEVDKLFETKGLDYLDREKAKR 86 >KZT64171.1 putative CipC-like antibiotic response protein, partial [Daedalea quercina L-15889] Length = 113 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 +E +H +KE+LAG AA E+DKLAETKGLDYIDREKAKR Sbjct: 56 QEPSHPVMKELLAGFAAAEIDKLAETKGLDYIDREKAKR 94 >OHW89794.1 cipc-like antibiotic response protein, partial [Colletotrichum incanum] Length = 118 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KE+L G+A EVDKL ETKGLDY+DREKAKR Sbjct: 47 EPVKHAFAKELLVGIAGAEVDKLVETKGLDYLDREKAKR 85 >KZL87511.1 cipc-like antibiotic response protein [Colletotrichum incanum] Length = 120 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V H F KE+L G+A EVDKL ETKGLDY+DREKAKR Sbjct: 49 EPVKHAFAKELLVGIAGAEVDKLVETKGLDYLDREKAKR 87 >CRK28579.1 hypothetical protein BN1708_015254 [Verticillium longisporum] Length = 175 Score = 63.2 bits (152), Expect = 5e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 E V+H F KE+LAG A EVDKL ETKGLDYIDREKAKR Sbjct: 49 EPVHHAFAKELLAGFAGAEVDKLVETKGLDYIDREKAKR 87 >EPT00272.1 hypothetical protein FOMPIDRAFT_1049855 [Fomitopsis pinicola FP-58527 SS1] Length = 250 Score = 64.3 bits (155), Expect = 5e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 EEVNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 +E NH +KE+LAG AA E+DKLAETKGLDY+DREKAKR Sbjct: 59 QEPNHALMKELLAGFAAAEIDKLAETKGLDYLDREKAKR 97 >CRK26369.1 hypothetical protein BN1708_018238, partial [Verticillium longisporum] Length = 121 Score = 61.6 bits (148), Expect = 6e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 7 VNHGFIKEMLAGVAAGEVDKLAETKGLDYIDREKAKR 117 V+H F KE+LAG A EVDKL ETKGLDYIDREKAKR Sbjct: 63 VHHAFAKELLAGFAGAEVDKLVETKGLDYIDREKAKR 99