BLASTX nr result
ID: Phellodendron21_contig00043566
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043566 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006433515.1 hypothetical protein CICLE_v10004048mg [Citrus cl... 82 3e-16 XP_008453700.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-15 XP_004144815.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-15 XP_006472181.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-15 XP_016177445.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 5e-14 XP_015939743.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 5e-14 GAV74318.1 PPR domain-containing protein/PPR_1 domain-containing... 72 6e-13 KDO81699.1 hypothetical protein CISIN_1g042503mg, partial [Citru... 70 5e-12 XP_009757542.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 XP_010259360.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 KYP41157.1 Pentatricopeptide repeat-containing protein At1g09190... 68 2e-11 XP_003535324.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 2e-11 XP_018820697.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-11 XP_004495670.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-11 XP_003591206.1 PPR containing plant-like protein [Medicago trunc... 67 5e-11 OAY43972.1 hypothetical protein MANES_08G112300 [Manihot esculenta] 66 9e-11 XP_009593715.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_015874918.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_014512613.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_017413636.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 >XP_006433515.1 hypothetical protein CICLE_v10004048mg [Citrus clementina] ESR46755.1 hypothetical protein CICLE_v10004048mg [Citrus clementina] Length = 484 Score = 81.6 bits (200), Expect = 3e-16 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MSKSLIEIE KILRLLHG TRTHLT+IHAHFLRHKLHQSN ILA Sbjct: 1 MSKSLIEIERKILRLLHGRNTRTHLTQIHAHFLRHKLHQSNLILA 45 >XP_008453700.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Cucumis melo] Length = 484 Score = 79.7 bits (195), Expect = 2e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MSK+ +EIE +ILRLLHGHK+RTHLT+IHAHFLRH LHQSNQILA Sbjct: 1 MSKNCMEIERRILRLLHGHKSRTHLTQIHAHFLRHGLHQSNQILA 45 >XP_004144815.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Cucumis sativus] KGN60987.1 hypothetical protein Csa_2G033910 [Cucumis sativus] Length = 484 Score = 79.7 bits (195), Expect = 2e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MSK+ +EIE +ILRLLHGHK+RTHLT+IHAHFLRH LHQSNQILA Sbjct: 1 MSKNCMEIERRILRLLHGHKSRTHLTQIHAHFLRHGLHQSNQILA 45 >XP_006472181.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Citrus sinensis] Length = 484 Score = 79.3 bits (194), Expect = 2e-15 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 M KSLIEIE KILRLLHG TRTHLT+IHAHFLRHKLHQSN ILA Sbjct: 1 MIKSLIEIERKILRLLHGRNTRTHLTQIHAHFLRHKLHQSNLILA 45 >XP_016177445.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Arachis ipaensis] Length = 484 Score = 75.5 bits (184), Expect = 5e-14 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS+ IEIE KILRLLHGH TRTHLTEIHA FLRH LH SNQIL+ Sbjct: 1 MSRGYIEIERKILRLLHGHTTRTHLTEIHAQFLRHNLHHSNQILS 45 >XP_015939743.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Arachis duranensis] Length = 484 Score = 75.5 bits (184), Expect = 5e-14 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS+ IEIE KILRLLHGH TRTHLTEIHA FLRH LH SNQIL+ Sbjct: 1 MSRGCIEIERKILRLLHGHTTRTHLTEIHAQFLRHNLHHSNQILS 45 >GAV74318.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 484 Score = 72.4 bits (176), Expect = 6e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 M ++ +E+E KIL LLHGHKTRT L EIHAHFLRH LH+SNQILA Sbjct: 1 MGRAWVEVEKKILSLLHGHKTRTRLLEIHAHFLRHNLHRSNQILA 45 >KDO81699.1 hypothetical protein CISIN_1g042503mg, partial [Citrus sinensis] Length = 477 Score = 69.7 bits (169), Expect = 5e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 151 IECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 IE KILRLLHG TRTHLT+IHAHFLRHKLHQSN ILA Sbjct: 1 IERKILRLLHGRNTRTHLTQIHAHFLRHKLHQSNLILA 38 >XP_009757542.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Nicotiana sylvestris] XP_016435370.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Nicotiana tabacum] Length = 484 Score = 68.9 bits (167), Expect = 1e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 M++ E+E +ILRLLHGHK+RTHLT+IHAH LRH LH SNQ+L+ Sbjct: 1 MNRGSREVERRILRLLHGHKSRTHLTQIHAHILRHHLHHSNQLLS 45 >XP_010259360.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Nelumbo nucifera] Length = 484 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS+ E E +ILRLLHGH TR LT++HAHFLRH LHQSNQILA Sbjct: 1 MSRCCREAERRILRLLHGHTTRLQLTQVHAHFLRHNLHQSNQILA 45 >KYP41157.1 Pentatricopeptide repeat-containing protein At1g09190 family [Cajanus cajan] Length = 483 Score = 67.8 bits (164), Expect = 2e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +1 Query: 148 EIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 EIE KILRLLHG KTRT LT+IHAHFLRH LH SNQILA Sbjct: 6 EIERKILRLLHGAKTRTQLTQIHAHFLRHGLHHSNQILA 44 >XP_003535324.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Glycine max] KRH33834.1 hypothetical protein GLYMA_10G148000 [Glycine max] Length = 483 Score = 67.8 bits (164), Expect = 2e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +1 Query: 148 EIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 EIE KILRLLHG KTR+HLTEIH HFLRH L QSNQILA Sbjct: 6 EIERKILRLLHGGKTRSHLTEIHGHFLRHGLQQSNQILA 44 >XP_018820697.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Juglans regia] Length = 484 Score = 67.4 bits (163), Expect = 3e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MSK+ E E ++LRLLHGHKTRT + +IHAHFLRH L QSNQ+LA Sbjct: 1 MSKAYREAERRVLRLLHGHKTRTQIPQIHAHFLRHGLDQSNQVLA 45 >XP_004495670.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Cicer arietinum] Length = 485 Score = 67.4 bits (163), Expect = 3e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MSKSL +IE +IL LLH KT THL +IHAHFLRH LHQSNQIL+ Sbjct: 1 MSKSLQKIERQILHLLHNTKTHTHLPQIHAHFLRHGLHQSNQILS 45 >XP_003591206.1 PPR containing plant-like protein [Medicago truncatula] AES61457.1 PPR containing plant-like protein [Medicago truncatula] Length = 490 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 M+KSL +IE KIL LLH KT+THL +IHAHFLRH LH SNQIL+ Sbjct: 1 MNKSLQKIESKILHLLHNTKTQTHLPQIHAHFLRHGLHHSNQILS 45 >OAY43972.1 hypothetical protein MANES_08G112300 [Manihot esculenta] Length = 484 Score = 66.2 bits (160), Expect = 9e-11 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS + EIE KILRLLHGH TRT L +IHAHFLRH LHQ N ILA Sbjct: 1 MSGTCREIERKILRLLHGHDTRTQLRQIHAHFLRHGLHQLNHILA 45 >XP_009593715.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Nicotiana tomentosiformis] XP_016460299.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Nicotiana tabacum] Length = 484 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 M++ E+E +ILRLLHGHK+RT LT+IHAH LRH LH SNQ+L+ Sbjct: 1 MNRGSREVERRILRLLHGHKSRTQLTQIHAHILRHHLHHSNQLLS 45 >XP_015874918.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Ziziphus jujuba] Length = 486 Score = 65.9 bits (159), Expect = 1e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS S E+E ++LRLLHG KTRTHL++IHA+FLRH L+QSNQ+L+ Sbjct: 1 MSWSCREVERRVLRLLHGQKTRTHLSQIHAYFLRHGLNQSNQVLS 45 >XP_014512613.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Vigna radiata var. radiata] Length = 479 Score = 65.5 bits (158), Expect = 2e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS+S EIE KILRLLHG K T LT+IHAHFLRH LHQSNQILA Sbjct: 1 MSRSR-EIERKILRLLHGAKNPTQLTQIHAHFLRHGLHQSNQILA 44 >XP_017413636.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Vigna angularis] KOM35471.1 hypothetical protein LR48_Vigan02g162100 [Vigna angularis] BAT95115.1 hypothetical protein VIGAN_08178000 [Vigna angularis var. angularis] Length = 479 Score = 65.5 bits (158), Expect = 2e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +1 Query: 130 MSKSLIEIECKILRLLHGHKTRTHLTEIHAHFLRHKLHQSNQILA 264 MS+S EIE KILRLLHG K T LT+IHAHFLRH LHQSNQILA Sbjct: 1 MSRSR-EIERKILRLLHGAKNPTQLTQIHAHFLRHGLHQSNQILA 44