BLASTX nr result
ID: Phellodendron21_contig00043513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043513 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO85732.1 hypothetical protein CISIN_1g033512mg [Citrus sinensis] 54 3e-07 >KDO85732.1 hypothetical protein CISIN_1g033512mg [Citrus sinensis] Length = 99 Score = 54.3 bits (129), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 252 GQSIFLYLCMNSHKFCVLTWLQCCRYLVPADL 347 G FL++CMNSHKF + T LQCCRYLVPADL Sbjct: 7 GIPFFLFICMNSHKFYIPTCLQCCRYLVPADL 38