BLASTX nr result
ID: Phellodendron21_contig00043468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043468 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018841838.1 PREDICTED: uncharacterized protein LOC109006879 [... 55 4e-07 >XP_018841838.1 PREDICTED: uncharacterized protein LOC109006879 [Juglans regia] Length = 203 Score = 55.5 bits (132), Expect = 4e-07 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 1/86 (1%) Frame = +3 Query: 24 AFD*VLNKLKGFSKLVGVSCDGFEDRPLGLSKKLEAMRVGGSLSTSIKPSSKGARE*KRL 203 A D VL K++ F V +S DG+ED+ + L +EA R ST +K + K RE KRL Sbjct: 120 ASDWVLKKVEEFHGWVEISYDGYEDQFMALLVAMEANR-----STVMKSAVKKDRELKRL 174 Query: 204 ECSVNYDDK-GSEARR*VEGRLVGIV 278 +CS+NYD+K G+ R +GR V V Sbjct: 175 QCSINYDNKEGTSGRDRAKGRDVSFV 200