BLASTX nr result
ID: Phellodendron21_contig00043274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043274 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006430320.1 hypothetical protein CICLE_v10013406mg [Citrus cl... 52 7e-06 >XP_006430320.1 hypothetical protein CICLE_v10013406mg [Citrus clementina] ESR43560.1 hypothetical protein CICLE_v10013406mg [Citrus clementina] Length = 183 Score = 51.6 bits (122), Expect = 7e-06 Identities = 33/65 (50%), Positives = 40/65 (61%) Frame = +2 Query: 62 MAEKSNDVKKKGVCYDDSEGDQGDPYGLSQLLSLMKQFPGPTSTPNPSTRKKLLVLSIGG 241 MAEKS D+KKKG+ YDDS+ D+GD L+ L N RKKL+VLSIGG Sbjct: 1 MAEKSEDLKKKGISYDDSD-DEGDSTCGLLLMKL-----------NLVPRKKLIVLSIGG 48 Query: 242 LLCHR 256 LL +R Sbjct: 49 LLFYR 53