BLASTX nr result
ID: Phellodendron21_contig00043221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043221 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006474565.1 PREDICTED: uncharacterized protein LOC102611966 [... 54 6e-06 XP_006452905.1 hypothetical protein CICLE_v10008008mg [Citrus cl... 54 6e-06 >XP_006474565.1 PREDICTED: uncharacterized protein LOC102611966 [Citrus sinensis] XP_015384588.1 PREDICTED: uncharacterized protein LOC102611966 [Citrus sinensis] KDO73758.1 hypothetical protein CISIN_1g010045mg [Citrus sinensis] Length = 519 Score = 53.9 bits (128), Expect = 6e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 292 HHMSLNTNIILGKPIRGSIMVNGCNGALKQEVRNSLCIAR 173 + M LNTNII+GKPI SI+VNGCN A+K+E RNS C AR Sbjct: 475 NQMPLNTNIIIGKPIGESILVNGCNRAVKEE-RNSQCTAR 513 >XP_006452905.1 hypothetical protein CICLE_v10008008mg [Citrus clementina] ESR66145.1 hypothetical protein CICLE_v10008008mg [Citrus clementina] Length = 519 Score = 53.9 bits (128), Expect = 6e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 292 HHMSLNTNIILGKPIRGSIMVNGCNGALKQEVRNSLCIAR 173 + M LNTNII+GKPI SI+VNGCN A+K+E RNS C AR Sbjct: 475 NQMPLNTNIIIGKPIGESILVNGCNRAVKEE-RNSQCTAR 513