BLASTX nr result
ID: Phellodendron21_contig00043168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043168 (509 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006427057.1 hypothetical protein CICLE_v10025241mg [Citrus cl... 99 7e-21 KDO48843.1 hypothetical protein CISIN_1g008452mg [Citrus sinensis] 98 9e-21 XP_015386545.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920... 98 9e-21 XP_015386537.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920... 98 9e-21 OMO66693.1 hypothetical protein COLO4_30418 [Corchorus olitorius] 94 2e-19 XP_015386920.1 PREDICTED: uncharacterized protein LOC107177534 [... 91 1e-18 OMO54083.1 hypothetical protein CCACVL1_28074 [Corchorus capsula... 85 1e-17 XP_006465560.1 PREDICTED: F-box/LRR-repeat protein At5g02910-lik... 86 1e-16 KDO56937.1 hypothetical protein CISIN_1g031566mg [Citrus sinensis] 80 8e-16 XP_006465531.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 82 5e-15 XP_006427013.1 hypothetical protein CICLE_v10025305mg [Citrus cl... 82 5e-15 XP_006465530.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 82 5e-15 XP_006427014.1 hypothetical protein CICLE_v10025305mg [Citrus cl... 82 5e-15 XP_006426943.1 hypothetical protein CICLE_v10025322mg [Citrus cl... 81 1e-14 XP_015386727.1 PREDICTED: uncharacterized protein LOC107177459 [... 80 1e-14 KDO56944.1 hypothetical protein CISIN_1g039643mg [Citrus sinensis] 80 1e-14 XP_006465627.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 80 3e-14 XP_006465593.1 PREDICTED: putative F-box/FBD/LRR-repeat protein ... 77 2e-13 XP_006427047.1 hypothetical protein CICLE_v10026860mg [Citrus cl... 70 5e-13 XP_006435997.1 hypothetical protein CICLE_v10033697mg [Citrus cl... 75 1e-12 >XP_006427057.1 hypothetical protein CICLE_v10025241mg [Citrus clementina] XP_006427058.1 hypothetical protein CICLE_v10025241mg [Citrus clementina] ESR40297.1 hypothetical protein CICLE_v10025241mg [Citrus clementina] ESR40298.1 hypothetical protein CICLE_v10025241mg [Citrus clementina] Length = 583 Score = 98.6 bits (244), Expect = 7e-21 Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLKQ 229 S + LLDG F IC PRTL++ T + R FI WLY L+N CC K W HYLK Sbjct: 479 SEYEILLDGVFWICYPRTLSLSTVNKGRPFIVWLYDYLRNPAKKCCCSDHTKSWWHYLKD 538 Query: 230 VLFESFKSSEGKSLDINSLMKL---WPNLPDGALWLHLEWCFD 349 ESFK G+ + + L +L WP +PDG L LHL+WCF+ Sbjct: 539 AKIESFKLIHGRKFNADELHQLIDEWPQVPDGDLQLHLDWCFN 581 >KDO48843.1 hypothetical protein CISIN_1g008452mg [Citrus sinensis] Length = 565 Score = 98.2 bits (243), Expect = 9e-21 Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLKQ 229 S + LLDG F IC PRTL++ T + R FI WLY L+N CC K W HYLK Sbjct: 461 SEYEILLDGVFWICYPRTLSLSTVNKGRPFIVWLYDYLRNPAKKCCCSDHTKSWWHYLKD 520 Query: 230 VLFESFKSSEGKSLDINSLMKL---WPNLPDGALWLHLEWCFD 349 ESFK G+ + + L +L WP +PDG L LHL+WCF+ Sbjct: 521 AKIESFKLIHGQKFNADELHQLIDEWPQVPDGDLQLHLDWCFN 563 >XP_015386545.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920-like isoform X2 [Citrus sinensis] XP_015386550.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920-like isoform X2 [Citrus sinensis] Length = 565 Score = 98.2 bits (243), Expect = 9e-21 Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLKQ 229 S + LLDG F IC PRTL++ T + R FI WLY L+N CC K W HYLK Sbjct: 461 SEYEILLDGVFWICYPRTLSLSTVNKGRPFIVWLYDYLRNPAKKCCCSDHTKSWWHYLKD 520 Query: 230 VLFESFKSSEGKSLDINSLMKL---WPNLPDGALWLHLEWCFD 349 ESFK G+ + + L +L WP +PDG L LHL+WCF+ Sbjct: 521 AKIESFKLIHGQKFNADELHQLIDEWPQVPDGDLQLHLDWCFN 563 >XP_015386537.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920-like isoform X1 [Citrus sinensis] XP_015386541.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920-like isoform X1 [Citrus sinensis] XP_015386543.1 PREDICTED: F-box/FBD/LRR-repeat protein At3g26920-like isoform X1 [Citrus sinensis] Length = 567 Score = 98.2 bits (243), Expect = 9e-21 Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLKQ 229 S + LLDG F IC PRTL++ T + R FI WLY L+N CC K W HYLK Sbjct: 463 SEYEILLDGVFWICYPRTLSLSTVNKGRPFIVWLYDYLRNPAKKCCCSDHTKSWWHYLKD 522 Query: 230 VLFESFKSSEGKSLDINSLMKL---WPNLPDGALWLHLEWCFD 349 ESFK G+ + + L +L WP +PDG L LHL+WCF+ Sbjct: 523 AKIESFKLIHGQKFNADELHQLIDEWPQVPDGDLQLHLDWCFN 565 >OMO66693.1 hypothetical protein COLO4_30418 [Corchorus olitorius] Length = 541 Score = 94.4 bits (233), Expect = 2e-19 Identities = 47/117 (40%), Positives = 63/117 (53%), Gaps = 8/117 (6%) Frame = +2 Query: 26 KFQKLH-----PASAFSALLDGAFGICCPRTLTVPT---GSLCRKFIKWLYKELKNRDAS 181 + Q+LH P S ++A+LD F +C P+TL++PT + F W+Y+ L N D Sbjct: 423 EIQELHLTVVIPESEYAAVLDAYFSVCHPKTLSLPTHHGDNERSNFYMWVYETLVNGDTY 482 Query: 182 CCKFHRIKCWRHYLKQVLFESFKSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 CC +KCWRHYLK + ESF D W NLP+G + LEWCFDV Sbjct: 483 CCSCSNVKCWRHYLKDIKLESFHGKVAPP-DSGEWKNEWRNLPEGTVGFALEWCFDV 538 >XP_015386920.1 PREDICTED: uncharacterized protein LOC107177534 [Citrus sinensis] Length = 358 Score = 90.9 bits (224), Expect = 1e-18 Identities = 49/114 (42%), Positives = 60/114 (52%), Gaps = 15/114 (13%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTV-PTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S + LLDG F I P+ L + P R F+ W Y L+N +CC +IKCWRHYLK Sbjct: 243 SEYEILLDGLFWIFYPKNLCLSPENWRYRPFVMWFYDHLRNISTNCCNGRQIKCWRHYLK 302 Query: 227 QVLFESF----KSSEGKSLDINS----------LMKLWPNLPDGALWLHLEWCF 346 + ESF +SSE D+ S LM WP LP G LWL L+WCF Sbjct: 303 GINIESFDPLQESSEVNYADVPSRGYKVNNSDELMDRWPLLPQGDLWLRLDWCF 356 >OMO54083.1 hypothetical protein CCACVL1_28074 [Corchorus capsularis] Length = 186 Score = 85.1 bits (209), Expect = 1e-17 Identities = 41/106 (38%), Positives = 57/106 (53%), Gaps = 3/106 (2%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPT---GSLCRKFIKWLYKELKNRDASCCKFHRIKCWR 214 P S ++A++DG F +C P+ L +PT + F W+Y+ L N D C +KCWR Sbjct: 79 PESEYAAVIDGYFSVCHPKNLYLPTYHGHNERSNFYIWVYETLVNGDTYYCSCSNVKCWR 138 Query: 215 HYLKQVLFESFKSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 HYLK + ESF+ D + W NLP+G + LEWC DV Sbjct: 139 HYLKDIKLESFRGKVAPP-DSGAWKNEWRNLPEGTVRFALEWCLDV 183 >XP_006465560.1 PREDICTED: F-box/LRR-repeat protein At5g02910-like isoform X1 [Citrus sinensis] Length = 544 Score = 86.3 bits (212), Expect = 1e-16 Identities = 46/103 (44%), Positives = 55/103 (53%), Gaps = 4/103 (3%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S + +LDG F IC PRTL + T FI WLY L+N + C IK WR+YL Sbjct: 440 SEYEIVLDGIFWICYPRTLCLSTMYEEQHPFIVWLYDYLRNPELKNCNSDDIKSWRYYLM 499 Query: 227 QVLFESFKSSEGKSL---DINSLMKLWPNLPDGALWLHLEWCF 346 ESFK G L ++N M WP PDG L LHL+WCF Sbjct: 500 DAKIESFKHFGGPMLNSDELNQFMDEWPKFPDGFLRLHLDWCF 542 >KDO56937.1 hypothetical protein CISIN_1g031566mg [Citrus sinensis] Length = 157 Score = 79.7 bits (195), Expect = 8e-16 Identities = 43/101 (42%), Positives = 57/101 (56%), Gaps = 2/101 (1%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCR-KFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S ++ALLD F IC P+ L++ +G R KFIKWL EL N CC R+KCWRHYLK Sbjct: 53 SKYAALLDSIFWICFPKFLSITSGGENRNKFIKWLCMELMNEYVYCCNSLRMKCWRHYLK 112 Query: 227 QVLFESFKSSE-GKSLDINSLMKLWPNLPDGALWLHLEWCF 346 + S + E + +DI++L+ P L LEW F Sbjct: 113 GFVISSSEMKEDNEPVDIDNLLDNLSTRPSETLRFRLEWSF 153 >XP_006465531.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Citrus sinensis] Length = 542 Score = 81.6 bits (200), Expect = 5e-15 Identities = 45/105 (42%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P S + LLD F IC PRTL V KFI WL +L RD +CC H IKCWRHY Sbjct: 433 PLSDYETLLDCVFWICHPRTLRVNVMFEEDHKFITWLSDQLWIRDVNCCNSHPIKCWRHY 492 Query: 221 LKQVLFESF-KSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 L + E+F ++ LD+++LM W G HL+WC V Sbjct: 493 LNDLKTENFLLVNDQIFLDVDNLMDGWTTRTRGVSEFHLDWCVPV 537 >XP_006427013.1 hypothetical protein CICLE_v10025305mg [Citrus clementina] ESR40253.1 hypothetical protein CICLE_v10025305mg [Citrus clementina] Length = 542 Score = 81.6 bits (200), Expect = 5e-15 Identities = 45/105 (42%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P S + LLD F IC PRTL V KFI WL +L RD +CC H IKCWRHY Sbjct: 433 PLSDYETLLDCVFWICHPRTLRVNVMFEEDHKFITWLSDQLWIRDVNCCNSHPIKCWRHY 492 Query: 221 LKQVLFESF-KSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 L + E+F ++ LD+++LM W G HL+WC V Sbjct: 493 LNDLKTENFLLVNDQIFLDVDNLMDGWTTRTRGVSEFHLDWCVPV 537 >XP_006465530.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Citrus sinensis] Length = 551 Score = 81.6 bits (200), Expect = 5e-15 Identities = 45/105 (42%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P S + LLD F IC PRTL V KFI WL +L RD +CC H IKCWRHY Sbjct: 442 PLSDYETLLDCVFWICHPRTLRVNVMFEEDHKFITWLSDQLWIRDVNCCNSHPIKCWRHY 501 Query: 221 LKQVLFESF-KSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 L + E+F ++ LD+++LM W G HL+WC V Sbjct: 502 LNDLKTENFLLVNDQIFLDVDNLMDGWTTRTRGVSEFHLDWCVPV 546 >XP_006427014.1 hypothetical protein CICLE_v10025305mg [Citrus clementina] ESR40254.1 hypothetical protein CICLE_v10025305mg [Citrus clementina] Length = 551 Score = 81.6 bits (200), Expect = 5e-15 Identities = 45/105 (42%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P S + LLD F IC PRTL V KFI WL +L RD +CC H IKCWRHY Sbjct: 442 PLSDYETLLDCVFWICHPRTLRVNVMFEEDHKFITWLSDQLWIRDVNCCNSHPIKCWRHY 501 Query: 221 LKQVLFESF-KSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 L + E+F ++ LD+++LM W G HL+WC V Sbjct: 502 LNDLKTENFLLVNDQIFLDVDNLMDGWTTRTRGVSEFHLDWCVPV 546 >XP_006426943.1 hypothetical protein CICLE_v10025322mg [Citrus clementina] ESR40183.1 hypothetical protein CICLE_v10025322mg [Citrus clementina] Length = 542 Score = 80.9 bits (198), Expect = 1e-14 Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 2/101 (1%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCR-KFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S ++ALLDG F IC P+ L++ +G R KFIKWL EL N CC R+KCWRHYL+ Sbjct: 438 SKYAALLDGIFWICFPKFLSITSGGENRNKFIKWLCMELMNEYVYCCNSLRMKCWRHYLR 497 Query: 227 QVLFESFKSSE-GKSLDINSLMKLWPNLPDGALWLHLEWCF 346 + S + E + +DI++L+ P L LEW F Sbjct: 498 GFVISSSEMKEDNEPVDIDNLLDNLSTRPSETLRFRLEWSF 538 >XP_015386727.1 PREDICTED: uncharacterized protein LOC107177459 [Citrus sinensis] Length = 520 Score = 80.5 bits (197), Expect = 1e-14 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 14/115 (12%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P + L+DG F IC P+ L +P + +FI+WL + L NR+ CCK IKCWRHY Sbjct: 401 PIQEYKNLMDGIFWICYPKNLYLPKQFNASSQFIEWLLELLWNRNEKCCKSCPIKCWRHY 460 Query: 221 LKQVLFESF-KSSEGKSLDINS------------LMKLWPNLPDGALWLHLEWCF 346 LK SF + + + ++I++ L + P LPDG L+LEWCF Sbjct: 461 LKNTKTASFLPNGDARPINIDNWRDRLPMLPDGYLRERLPTLPDGNFKLNLEWCF 515 >KDO56944.1 hypothetical protein CISIN_1g039643mg [Citrus sinensis] Length = 520 Score = 80.5 bits (197), Expect = 1e-14 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 14/115 (12%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIKCWRHY 220 P + L+DG F IC P+ L +P + +FI+WL + L NR+ CCK IKCWRHY Sbjct: 401 PIQEYKNLMDGIFWICYPKNLYLPKQFNASSQFIEWLLELLWNRNEKCCKSCPIKCWRHY 460 Query: 221 LKQVLFESF-KSSEGKSLDINS------------LMKLWPNLPDGALWLHLEWCF 346 LK SF + + + ++I++ L + P LPDG L+LEWCF Sbjct: 461 LKNTKTASFLPNGDARPINIDNWRDRLPMLPDGYLRERLPTLPDGNFKLNLEWCF 515 >XP_006465627.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like [Citrus sinensis] XP_006465628.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like [Citrus sinensis] XP_006465629.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like [Citrus sinensis] Length = 542 Score = 79.7 bits (195), Expect = 3e-14 Identities = 43/101 (42%), Positives = 57/101 (56%), Gaps = 2/101 (1%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTVPTGSLCR-KFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S ++ALLD F IC P+ L++ +G R KFIKWL EL N CC R+KCWRHYLK Sbjct: 438 SKYAALLDSIFWICFPKFLSITSGGENRNKFIKWLCMELMNEYVYCCNSLRMKCWRHYLK 497 Query: 227 QVLFESFKSSE-GKSLDINSLMKLWPNLPDGALWLHLEWCF 346 + S + E + +DI++L+ P L LEW F Sbjct: 498 GFVISSSEMKEDNEPVDIDNLLDNLSTRPSETLRFRLEWSF 538 >XP_006465593.1 PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 isoform X1 [Citrus sinensis] Length = 531 Score = 77.4 bits (189), Expect = 2e-13 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 1/102 (0%) Frame = +2 Query: 50 SAFSALLDGAFGICCPRTLTV-PTGSLCRKFIKWLYKELKNRDASCCKFHRIKCWRHYLK 226 S + LLDG F I P+ L + P R F+ W Y L+N +CC +IKCWRHYLK Sbjct: 441 SEYEILLDGLFWIFYPKNLCLSPENWRYRPFVMWFYDHLRNISTNCCNGRQIKCWRHYLK 500 Query: 227 QVLFESFKSSEGKSLDINSLMKLWPNLPDGALWLHLEWCFDV 352 + ESF + S +G LWL L+WCF V Sbjct: 501 GINIESFDPLQESS--------------EGDLWLRLDWCFPV 528 >XP_006427047.1 hypothetical protein CICLE_v10026860mg [Citrus clementina] ESR40287.1 hypothetical protein CICLE_v10026860mg [Citrus clementina] Length = 88 Score = 70.5 bits (171), Expect = 5e-13 Identities = 33/71 (46%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Frame = +2 Query: 143 KWLYKELKNRDASCCKFHRIKCWRHYLKQVLFESFKSSEGKSL---DINSLMKLWPNLPD 313 KWLY L+N + C IK WR+YL ESFK G L ++N M WP PD Sbjct: 16 KWLYDYLRNPELKNCNSDDIKSWRYYLMDAKIESFKQFGGPMLNSDELNQFMDEWPKFPD 75 Query: 314 GALWLHLEWCF 346 G L LHL+WCF Sbjct: 76 GFLRLHLDWCF 86 >XP_006435997.1 hypothetical protein CICLE_v10033697mg [Citrus clementina] ESR49237.1 hypothetical protein CICLE_v10033697mg [Citrus clementina] Length = 540 Score = 75.1 bits (183), Expect = 1e-12 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = +2 Query: 44 PASAFSALLDGAFGICCPRTLTVPTG-SLCRKFIKWLYKELKNRDASCCKFHRIK-CWRH 217 P S + ALLDG F IC PRTL V T +K I+WLY++L+NRD +CC H IK CWRH Sbjct: 421 PLSDYEALLDGVFQICYPRTLRVSTMFEEDKKLIEWLYEQLRNRDVTCCNPHHIKYCWRH 480 Query: 218 YLKQVLFESFKSSE 259 +L+ + + + E Sbjct: 481 HLEDIKIQRYLQIE 494