BLASTX nr result
ID: Phellodendron21_contig00043163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043163 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEK71475.1 hypothetical chloroplast RF2 (plastid) [Eucryphia luc... 55 2e-06 AEK71591.1 hypothetical chloroplast RF2 (plastid) [Terminalia ca... 54 6e-06 YP_009338673.1 hypothetical chloroplast RF2 (chloroplast) [Averr... 54 6e-06 ANY60256.1 hypothetical chloroplast RF21 (chloroplast) [Averrhoa... 54 6e-06 >AEK71475.1 hypothetical chloroplast RF2 (plastid) [Eucryphia lucida] Length = 2270 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 24 FPGSEESTWDLPITKMCIMPEINWGLWW*RN 116 F +ESTW LPITK CIMPE NWGLWW RN Sbjct: 152 FLDPKESTWVLPITKKCIMPESNWGLWWWRN 182 >AEK71591.1 hypothetical chloroplast RF2 (plastid) [Terminalia catappa] Length = 2271 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 24 FPGSEESTWDLPITKMCIMPEINWGLWW*RN 116 FP +ESTW LPITK CIMPE NWGL W RN Sbjct: 148 FPDPKESTWVLPITKKCIMPESNWGLRWWRN 178 >YP_009338673.1 hypothetical chloroplast RF2 (chloroplast) [Averrhoa carambola] YP_009338689.1 hypothetical chloroplast RF2 (chloroplast) [Averrhoa carambola] ANU80197.1 hypothetical chloroplast RF2 (chloroplast) [Averrhoa carambola] ANU80213.1 hypothetical chloroplast RF2 (chloroplast) [Averrhoa carambola] Length = 2290 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +3 Query: 24 FPGSEESTWDLPITKMCIMPEINWGLWW*RN*GLQKEEF 140 F +ESTW LPITK CIMPE NWG WW RN +K +F Sbjct: 153 FLDPKESTWFLPITKKCIMPESNWGSWWWRNWIGKKRDF 191 >ANY60256.1 hypothetical chloroplast RF21 (chloroplast) [Averrhoa carambola] ANY60257.1 hypothetical chloroplast RF21 (chloroplast) [Averrhoa carambola] Length = 2294 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +3 Query: 24 FPGSEESTWDLPITKMCIMPEINWGLWW*RN*GLQKEEF 140 F +ESTW LPITK CIMPE NWG WW RN +K +F Sbjct: 153 FLDPKESTWFLPITKKCIMPESNWGSWWWRNWIGKKRDF 191