BLASTX nr result
ID: Phellodendron21_contig00043136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043136 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019418588.1 PREDICTED: uncharacterized protein LOC109329375 [... 40 3e-08 GAU46447.1 hypothetical protein TSUD_402140 [Trifolium subterran... 47 9e-06 >XP_019418588.1 PREDICTED: uncharacterized protein LOC109329375 [Lupinus angustifolius] Length = 1695 Score = 40.4 bits (93), Expect(3) = 3e-08 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +1 Query: 154 CGRGVRQGNLLFPLFFCIAEEVFARG 231 C RGVRQG+ L PL FC+AE+V +RG Sbjct: 961 CTRGVRQGDPLSPLLFCLAEDVLSRG 986 Score = 38.1 bits (87), Expect(3) = 3e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +3 Query: 66 GADRITQFRPIALANLIFKIITK 134 GADRI +RPIALAN FKIITK Sbjct: 899 GADRIEDYRPIALANFQFKIITK 921 Score = 25.8 bits (55), Expect(3) = 3e-08 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 2 YSGSIYHNCWDIVRAEV 52 +SG Y N WDI+ EV Sbjct: 853 FSGCFYQNFWDIINIEV 869 >GAU46447.1 hypothetical protein TSUD_402140 [Trifolium subterraneum] Length = 1435 Score = 46.6 bits (109), Expect(2) = 9e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +1 Query: 142 GFFPCGRGVRQGNLLFPLFFCIAEEVFARG 231 G+F C RGVRQG+ L PL FC+AE+V +RG Sbjct: 919 GYFKCSRGVRQGDPLSPLLFCLAEDVLSRG 948 Score = 30.0 bits (66), Expect(2) = 9e-06 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +3 Query: 69 ADRITQFRPIALANLIFKIITK 134 AD I ++RPIA+ N FKII+K Sbjct: 862 ADTIDKYRPIAMTNFKFKIISK 883