BLASTX nr result
ID: Phellodendron21_contig00043129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043129 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006466213.1 PREDICTED: cleft lip and palate transmembrane pro... 60 3e-08 XP_006426404.1 hypothetical protein CICLE_v10025224mg [Citrus cl... 60 3e-08 >XP_006466213.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog [Citrus sinensis] Length = 592 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = +1 Query: 175 VFWYFASKIFAPKRPAGTEST*LMSNLVQRGEY 273 VFWYFASK FAPKRPAG ES LMSNL QRGEY Sbjct: 39 VFWYFASKFFAPKRPAGPESAQLMSNLFQRGEY 71 >XP_006426404.1 hypothetical protein CICLE_v10025224mg [Citrus clementina] ESR39644.1 hypothetical protein CICLE_v10025224mg [Citrus clementina] KDO58748.1 hypothetical protein CISIN_1g007700mg [Citrus sinensis] Length = 592 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = +1 Query: 175 VFWYFASKIFAPKRPAGTEST*LMSNLVQRGEY 273 VFWYFASK FAPKRPAG ES LMSNL QRGEY Sbjct: 39 VFWYFASKFFAPKRPAGPESAQLMSNLFQRGEY 71