BLASTX nr result
ID: Phellodendron21_contig00043087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043087 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006491052.1 PREDICTED: putative threonine aspartase isoform X... 63 1e-09 XP_006445098.1 hypothetical protein CICLE_v10024326mg [Citrus cl... 63 1e-09 >XP_006491052.1 PREDICTED: putative threonine aspartase isoform X2 [Citrus sinensis] Length = 404 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 160 WLVTERAKSQWRKYKSMLVDAEAKTDISAEGCSYEGGETAITS 288 W+VTERA++QWRKYKS+L DAEAKT+ SAEG S ETA TS Sbjct: 147 WMVTERARAQWRKYKSILADAEAKTNTSAEGHSSVAEETAFTS 189 >XP_006445098.1 hypothetical protein CICLE_v10024326mg [Citrus clementina] XP_006491051.1 PREDICTED: putative threonine aspartase isoform X1 [Citrus sinensis] ESR58338.1 hypothetical protein CICLE_v10024326mg [Citrus clementina] Length = 419 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 160 WLVTERAKSQWRKYKSMLVDAEAKTDISAEGCSYEGGETAITS 288 W+VTERA++QWRKYKS+L DAEAKT+ SAEG S ETA TS Sbjct: 162 WMVTERARAQWRKYKSILADAEAKTNTSAEGHSSVAEETAFTS 204