BLASTX nr result
ID: Phellodendron21_contig00043053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043053 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013899889.1 hypothetical protein MNEG_7092 [Monoraphidium neg... 79 3e-17 XP_005648025.1 thioredoxin-like protein [Coccomyxa subellipsoide... 82 5e-17 XP_005845941.1 hypothetical protein CHLNCDRAFT_36198 [Chlorella ... 78 2e-15 KXZ46198.1 hypothetical protein GPECTOR_46g267 [Gonium pectorale] 77 2e-15 XP_002958831.1 thioredoxin-like protein [Volvox carteri f. nagar... 76 2e-14 XP_011397564.1 Thioredoxin F, chloroplastic [Auxenochlorella pro... 70 5e-13 JAT74514.1 hypothetical protein g.35124, partial [Auxenochlorell... 70 3e-12 XP_013658756.1 PREDICTED: thioredoxin F2, chloroplastic-like [Br... 63 2e-10 XP_010451256.1 PREDICTED: thioredoxin F1, chloroplastic-like [Ca... 62 5e-10 OEL16320.1 Thioredoxin F, chloroplastic [Dichanthelium oligosant... 64 6e-10 XP_020193542.1 thioredoxin F, chloroplastic-like [Aegilops tausc... 64 6e-10 CBH32529.1 thioredoxin F-type, chloroplast precursor,putative, e... 64 6e-10 XP_003564899.1 PREDICTED: thioredoxin F, chloroplastic [Brachypo... 64 7e-10 XP_010926621.2 PREDICTED: thioredoxin F2, chloroplastic [Elaeis ... 62 8e-10 XP_015616604.1 PREDICTED: thioredoxin F, chloroplastic [Oryza sa... 63 9e-10 XP_013649843.1 PREDICTED: thioredoxin F2, chloroplastic-like [Br... 63 1e-09 XP_009126111.1 PREDICTED: thioredoxin F2, chloroplastic [Brassic... 63 1e-09 XP_004982992.1 PREDICTED: thioredoxin F, chloroplastic-like [Set... 62 2e-09 CDY69984.1 BnaA02g35040D [Brassica napus] 62 2e-09 XP_006645210.1 PREDICTED: thioredoxin F, chloroplastic [Oryza br... 62 2e-09 >XP_013899889.1 hypothetical protein MNEG_7092 [Monoraphidium neglectum] KIZ00870.1 hypothetical protein MNEG_7092 [Monoraphidium neglectum] Length = 72 Score = 79.3 bits (194), Expect = 3e-17 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = +2 Query: 8 KGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEKNV 184 K + VKFNCN NKELG+QLGI+VAPTF LY+ +K+ EMTGAK+D+LR +IE N+ Sbjct: 14 KTRGGQVVKFNCNKDNKELGKQLGIKVAPTFHLYRGREKLGEMTGAKVDKLREMIEANL 72 >XP_005648025.1 thioredoxin-like protein [Coccomyxa subellipsoidea C-169] EIE23481.1 thioredoxin-like protein [Coccomyxa subellipsoidea C-169] Length = 168 Score = 81.6 bits (200), Expect = 5e-17 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = +2 Query: 17 KAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEKNV 184 +A+ VKFNCN +NKELG LGI+VAPTF LY+ K+VA MTGAKIDELR LI+K++ Sbjct: 113 RAEIVKFNCNKNNKELGVSLGIKVAPTFHLYRAEKQVAMMTGAKIDELRELIDKHI 168 >XP_005845941.1 hypothetical protein CHLNCDRAFT_36198 [Chlorella variabilis] EFN53839.1 hypothetical protein CHLNCDRAFT_36198 [Chlorella variabilis] Length = 190 Score = 78.2 bits (191), Expect = 2e-15 Identities = 36/61 (59%), Positives = 48/61 (78%) Frame = +2 Query: 2 QEKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEKN 181 +E K + VKFNCN HNK+LG LGI+VAPTF LYK+ ++V +MTGAK ++LR LIEK+ Sbjct: 130 EELEGKVEIVKFNCNKHNKDLGISLGIKVAPTFLLYKDGQQVDKMTGAKTEQLRELIEKH 189 Query: 182 V 184 + Sbjct: 190 I 190 >KXZ46198.1 hypothetical protein GPECTOR_46g267 [Gonium pectorale] Length = 163 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +2 Query: 23 KFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEK 178 +FVK NCN NKELG QL I+VAPTFQLY+NS KVAEMTGAK+D+L +LI + Sbjct: 105 RFVKVNCNKANKELGVQLAIKVAPTFQLYRNSTKVAEMTGAKLDKLVALINE 156 >XP_002958831.1 thioredoxin-like protein [Volvox carteri f. nagariensis] EFJ40082.1 thioredoxin-like protein [Volvox carteri f. nagariensis] Length = 198 Score = 75.9 bits (185), Expect = 2e-14 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +2 Query: 23 KFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEK 178 +FVK NCN NKELG LGI+VAPTFQLY++S KVA+MTGAK+D+L SLI++ Sbjct: 138 RFVKVNCNKTNKELGIALGIKVAPTFQLYRSSTKVADMTGAKLDKLISLIDE 189 >XP_011397564.1 Thioredoxin F, chloroplastic [Auxenochlorella protothecoides] KFM24676.1 Thioredoxin F, chloroplastic [Auxenochlorella protothecoides] Length = 124 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 17 KAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 + + V+F C NKE+G +LGI+VAPTF LYK +KVA +TGAK DELR LIE Sbjct: 69 EVELVRFECKKENKEIGSKLGIKVAPTFFLYKKGEKVASLTGAKTDELRKLIE 121 >JAT74514.1 hypothetical protein g.35124, partial [Auxenochlorella protothecoides] Length = 220 Score = 70.1 bits (170), Expect = 3e-12 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 17 KAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 + + V+F C NKE+G +LGI+VAPTF LYK +KVA +TGAK DELR LIE Sbjct: 165 EVELVRFECKKENKEIGSKLGIKVAPTFFLYKKGEKVASLTGAKTDELRKLIE 217 >XP_013658756.1 PREDICTED: thioredoxin F2, chloroplastic-like [Brassica napus] Length = 106 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK + Q+LGIRV PTF++ K++K + E+ GAK DEL S IE Sbjct: 45 EKYQDMVFLKLDCNEENKPVAQELGIRVVPTFKILKDNKVIKEVAGAKFDELLSAIE 101 >XP_010451256.1 PREDICTED: thioredoxin F1, chloroplastic-like [Camelina sativa] Length = 93 Score = 61.6 bits (148), Expect = 5e-10 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK E F+K +CN N+ L ++LGIRV PTF++ K++K V E+TGAK D+L + IE Sbjct: 27 EKYEDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIE 83 >OEL16320.1 Thioredoxin F, chloroplastic [Dichanthelium oligosanthes] Length = 183 Score = 63.5 bits (153), Expect = 6e-10 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK F+K +CN NK L ++LGI+V PTF++ K+ K V E+TGAKIDEL IE Sbjct: 122 EKNPDVVFLKLDCNQDNKPLAKELGIKVVPTFKILKDGKVVKEVTGAKIDELAQAIE 178 >XP_020193542.1 thioredoxin F, chloroplastic-like [Aegilops tauschii subsp. tauschii] Length = 189 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEK 178 EK F+K +CN N+ L ++LGIRV PTF+++K+ K E+TGAKIDEL IE+ Sbjct: 128 EKDHDVVFLKLDCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 185 >CBH32529.1 thioredoxin F-type, chloroplast precursor,putative, expressed [Triticum aestivum] CDM85580.1 unnamed protein product [Triticum aestivum] Length = 189 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEK 178 EK F+K +CN N+ L ++LGIRV PTF+++K+ K E+TGAKIDEL IE+ Sbjct: 128 EKDHDVVFLKLDCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 185 >XP_003564899.1 PREDICTED: thioredoxin F, chloroplastic [Brachypodium distachyon] KQK11153.1 hypothetical protein BRADI_2g58440 [Brachypodium distachyon] Length = 192 Score = 63.5 bits (153), Expect = 7e-10 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIEK 178 EK F+K +CN N+ L ++LGIRV PTF+++K+ K E+TGAKIDEL IE+ Sbjct: 131 EKDHDVLFLKLDCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 188 >XP_010926621.2 PREDICTED: thioredoxin F2, chloroplastic [Elaeis guineensis] Length = 148 Score = 62.4 bits (150), Expect = 8e-10 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK F+K +CN NK L ++LGIRV PTF++ K+SK + E+TGAK+D+L + IE Sbjct: 87 EKHLDVVFLKLDCNQENKPLAKELGIRVVPTFKILKDSKVIKEVTGAKLDDLVAAIE 143 >XP_015616604.1 PREDICTED: thioredoxin F, chloroplastic [Oryza sativa Japonica Group] Q8S091.1 RecName: Full=Thioredoxin F, chloroplastic; Short=OsTrxf; AltName: Full=OsTrx03; Flags: Precursor BAB90300.1 putative thioredoxin F [Oryza sativa Japonica Group] BAF07081.1 Os01g0913000 [Oryza sativa Japonica Group] EAY76930.1 hypothetical protein OsI_04888 [Oryza sativa Indica Group] EAZ14590.1 hypothetical protein OsJ_04513 [Oryza sativa Japonica Group] BAG94981.1 unnamed protein product [Oryza sativa Japonica Group] BAS75851.1 Os01g0913000 [Oryza sativa Japonica Group] Length = 187 Score = 63.2 bits (152), Expect = 9e-10 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK L ++LGI+V PTF++ K+ K V E+TGAK+DEL IE Sbjct: 126 EKDQDVVFLKLDCNQDNKSLAKELGIKVVPTFKILKDGKVVKEVTGAKLDELIQAIE 182 >XP_013649843.1 PREDICTED: thioredoxin F2, chloroplastic-like [Brassica napus] Length = 187 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK + Q+LGIRV PTF++ K++K + E+ GAK DEL S IE Sbjct: 126 EKYQDMVFLKLDCNEENKPVAQELGIRVVPTFKILKDNKVIKEVAGAKFDELLSAIE 182 >XP_009126111.1 PREDICTED: thioredoxin F2, chloroplastic [Brassica rapa] Length = 187 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK + Q+LGIRV PTF++ K++K + E+ GAK DEL S IE Sbjct: 126 EKYQDMVFLKLDCNEENKPVAQELGIRVVPTFKILKDNKVIKEVAGAKFDELLSAIE 182 >XP_004982992.1 PREDICTED: thioredoxin F, chloroplastic-like [Setaria italica] KQK88889.1 hypothetical protein SETIT_037706mg [Setaria italica] Length = 181 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK F+K +CN NK L ++LGI+V PTF++ K+ K V E+TGAKIDEL IE Sbjct: 122 EKNLDVVFLKLDCNQDNKPLAKELGIKVVPTFKILKDGKVVKEVTGAKIDELAHAIE 178 >CDY69984.1 BnaA02g35040D [Brassica napus] Length = 186 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK + Q+LGIRV PTF++ K++K + E+ GAK DEL S IE Sbjct: 125 EKYQDMVFLKLDCNEDNKPVAQELGIRVVPTFKILKDNKVIKEVVGAKFDELLSAIE 181 >XP_006645210.1 PREDICTED: thioredoxin F, chloroplastic [Oryza brachyantha] Length = 187 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 5 EKGEKAKFVKFNCNAHNKELGQQLGIRVAPTFQLYKNSKKVAEMTGAKIDELRSLIE 175 EK + F+K +CN NK L ++LGI+V PTF++ K+ K V E+TGAKIDEL I+ Sbjct: 126 EKDQDVVFLKLDCNQDNKSLAKELGIKVVPTFKILKDGKVVKEVTGAKIDELIQAIK 182