BLASTX nr result
ID: Phellodendron21_contig00043034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043034 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006441989.1 hypothetical protein CICLE_v10022861mg [Citrus cl... 65 1e-10 XP_006478489.1 PREDICTED: protein AUXIN-REGULATED GENE INVOLVED ... 64 3e-10 >XP_006441989.1 hypothetical protein CICLE_v10022861mg [Citrus clementina] XP_006441990.1 hypothetical protein CICLE_v10022861mg [Citrus clementina] ESR55229.1 hypothetical protein CICLE_v10022861mg [Citrus clementina] ESR55230.1 hypothetical protein CICLE_v10022861mg [Citrus clementina] Length = 126 Score = 65.1 bits (157), Expect = 1e-10 Identities = 34/42 (80%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = -2 Query: 221 IMERGVRNV----VEKRKVEYHRSLSQGASRKLFSASYFTLE 108 IM+RGVR + VEKRKVEYHRS SQGASRKLFSASYFTLE Sbjct: 27 IMDRGVRKIATPPVEKRKVEYHRSYSQGASRKLFSASYFTLE 68 >XP_006478489.1 PREDICTED: protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE [Citrus sinensis] KDO49746.1 hypothetical protein CISIN_1g033126mg [Citrus sinensis] KDO49747.1 hypothetical protein CISIN_1g033126mg [Citrus sinensis] Length = 126 Score = 63.9 bits (154), Expect = 3e-10 Identities = 33/42 (78%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = -2 Query: 221 IMERGVRNV----VEKRKVEYHRSLSQGASRKLFSASYFTLE 108 IM+RGVR + VEKRKVEYHRS SQGASR+LFSASYFTLE Sbjct: 27 IMDRGVRKIATPPVEKRKVEYHRSYSQGASRRLFSASYFTLE 68