BLASTX nr result
ID: Phellodendron21_contig00042792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042792 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006429719.1 hypothetical protein CICLE_v10013296mg [Citrus cl... 99 1e-24 >XP_006429719.1 hypothetical protein CICLE_v10013296mg [Citrus clementina] ESR42959.1 hypothetical protein CICLE_v10013296mg [Citrus clementina] Length = 66 Score = 99.4 bits (246), Expect = 1e-24 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -1 Query: 380 MASLVLLVSELLRIQNPDLGSVETILYSCSLPPHVATQNILRNEADKDLEAEEDPQESRI 201 MASLVLLVSELLRIQNPDLGSVETILYSCSLP HVAT+N LRNEADKD EA +D QESRI Sbjct: 1 MASLVLLVSELLRIQNPDLGSVETILYSCSLPAHVATKNFLRNEADKDFEA-KDLQESRI 59