BLASTX nr result
ID: Phellodendron21_contig00042781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042781 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007676688.1 hypothetical protein BAUCODRAFT_148355 [Baudoinia... 54 1e-07 >XP_007676688.1 hypothetical protein BAUCODRAFT_148355 [Baudoinia panamericana UAMH 10762] EMC96801.1 hypothetical protein BAUCODRAFT_148355 [Baudoinia panamericana UAMH 10762] Length = 49 Score = 53.5 bits (127), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 QEAVATQTIYGMLGACVVLYLSPFAVDFAFKLV 100 QEA+ATQT+YG +G CV+LYLSPFAV +A KLV Sbjct: 17 QEAIATQTVYGAVGMCVLLYLSPFAVQWASKLV 49