BLASTX nr result
ID: Phellodendron21_contig00042775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042775 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO80294.1 hypothetical protein CISIN_1g009239mg [Citrus sinensis] 68 3e-11 XP_006475812.1 PREDICTED: zinc finger CCCH domain-containing pro... 68 3e-11 XP_006450976.1 hypothetical protein CICLE_v10007946mg [Citrus cl... 68 3e-11 >KDO80294.1 hypothetical protein CISIN_1g009239mg [Citrus sinensis] Length = 539 Score = 68.2 bits (165), Expect = 3e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +2 Query: 2 GHSSRTLTDFQGPKPLSEILKEKRRLGTVSDNDTCSC 112 GH SRTLTDFQGPKPLSEILKEKRR GTVSD DT SC Sbjct: 503 GHLSRTLTDFQGPKPLSEILKEKRRPGTVSDADTWSC 539 >XP_006475812.1 PREDICTED: zinc finger CCCH domain-containing protein 34-like [Citrus sinensis] XP_006475813.1 PREDICTED: zinc finger CCCH domain-containing protein 34-like [Citrus sinensis] Length = 539 Score = 68.2 bits (165), Expect = 3e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +2 Query: 2 GHSSRTLTDFQGPKPLSEILKEKRRLGTVSDNDTCSC 112 GH SRTLTDFQGPKPLSEILKEKRR GTVSD DT SC Sbjct: 503 GHLSRTLTDFQGPKPLSEILKEKRRPGTVSDADTWSC 539 >XP_006450976.1 hypothetical protein CICLE_v10007946mg [Citrus clementina] ESR64216.1 hypothetical protein CICLE_v10007946mg [Citrus clementina] Length = 539 Score = 68.2 bits (165), Expect = 3e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +2 Query: 2 GHSSRTLTDFQGPKPLSEILKEKRRLGTVSDNDTCSC 112 GH SRTLTDFQGPKPLSEILKEKRR GTVSD DT SC Sbjct: 503 GHLSRTLTDFQGPKPLSEILKEKRRPGTVSDADTWSC 539