BLASTX nr result
ID: Phellodendron21_contig00042713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042713 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO82333.1 hypothetical protein CISIN_1g007771mg [Citrus sinensis] 59 1e-07 XP_006483906.1 PREDICTED: protein trichome birefringence-like 2 ... 59 1e-07 XP_006438320.1 hypothetical protein CICLE_v10031033mg [Citrus cl... 59 1e-07 >KDO82333.1 hypothetical protein CISIN_1g007771mg [Citrus sinensis] Length = 590 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/54 (61%), Positives = 34/54 (62%) Frame = +1 Query: 226 MESKKVPFTEQLLSPRRKVVSXXXXXXXXXXXXXXXXXXSNPLKAPAVSPLFQG 387 MES+KV FTEQLLSPRRKVVS SN LKAPAVSPLFQG Sbjct: 1 MESRKVAFTEQLLSPRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQG 54 >XP_006483906.1 PREDICTED: protein trichome birefringence-like 2 [Citrus sinensis] Length = 590 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/54 (61%), Positives = 34/54 (62%) Frame = +1 Query: 226 MESKKVPFTEQLLSPRRKVVSXXXXXXXXXXXXXXXXXXSNPLKAPAVSPLFQG 387 MES+KV FTEQLLSPRRKVVS SN LKAPAVSPLFQG Sbjct: 1 MESRKVAFTEQLLSPRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQG 54 >XP_006438320.1 hypothetical protein CICLE_v10031033mg [Citrus clementina] ESR51560.1 hypothetical protein CICLE_v10031033mg [Citrus clementina] Length = 590 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/54 (61%), Positives = 34/54 (62%) Frame = +1 Query: 226 MESKKVPFTEQLLSPRRKVVSXXXXXXXXXXXXXXXXXXSNPLKAPAVSPLFQG 387 MES+KV FTEQLLSPRRKVVS SN LKAPAVSPLFQG Sbjct: 1 MESRKVAFTEQLLSPRRKVVSGFGLGVAATVIVFVVLLLSNSLKAPAVSPLFQG 54