BLASTX nr result
ID: Phellodendron21_contig00042702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042702 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006494434.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 52 3e-10 XP_006435493.1 hypothetical protein CICLE_v10003766mg, partial [... 52 3e-10 XP_008237875.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 51 1e-08 XP_015574671.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 49 6e-08 EEF52942.1 o-linked n-acetylglucosamine transferase, ogt, putati... 48 8e-08 XP_009334757.1 PREDICTED: tetratricopeptide repeat protein SKI3-... 50 8e-08 XP_011464990.1 PREDICTED: tetratricopeptide repeat protein 37 [F... 49 8e-08 XP_018506530.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 50 8e-08 XP_018498147.1 PREDICTED: tetratricopeptide repeat protein SKI3-... 50 8e-08 XP_012073532.1 PREDICTED: uncharacterized protein LOC105635143 [... 49 1e-07 KDP36716.1 hypothetical protein JCGZ_08007 [Jatropha curcas] 49 1e-07 ONI05313.1 hypothetical protein PRUPE_5G001100 [Prunus persica] 51 2e-07 ONI05311.1 hypothetical protein PRUPE_5G001100 [Prunus persica] 51 2e-07 ONI05312.1 hypothetical protein PRUPE_5G001100 [Prunus persica] 51 2e-07 ONI05310.1 hypothetical protein PRUPE_5G001100 [Prunus persica] 51 2e-07 ONI05309.1 hypothetical protein PRUPE_5G001100 [Prunus persica] 51 2e-07 XP_007210397.1 hypothetical protein PRUPE_ppa000907mg [Prunus pe... 51 2e-07 XP_018832964.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 49 3e-07 XP_018832966.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 49 3e-07 XP_018832967.1 PREDICTED: tetratricopeptide repeat protein SKI3 ... 49 3e-07 >XP_006494434.1 PREDICTED: tetratricopeptide repeat protein SKI3 [Citrus sinensis] Length = 1178 Score = 52.4 bits (124), Expect(2) = 3e-10 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 +VEFCQSPQKWVLRAIHTNPS RY Sbjct: 1146 RVEFCQSPQKWVLRAIHTNPSCLRY 1170 Score = 39.7 bits (91), Expect(2) = 3e-10 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLAM SKA SDS SR+ Sbjct: 1124 AELFFQMHLLAMLSKAGSDSSSRV 1147 >XP_006435493.1 hypothetical protein CICLE_v10003766mg, partial [Citrus clementina] ESR48733.1 hypothetical protein CICLE_v10003766mg, partial [Citrus clementina] KDO85306.1 hypothetical protein CISIN_1g045024mg, partial [Citrus sinensis] Length = 1173 Score = 52.4 bits (124), Expect(2) = 3e-10 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 +VEFCQSPQKWVLRAIHTNPS RY Sbjct: 1141 RVEFCQSPQKWVLRAIHTNPSCLRY 1165 Score = 39.7 bits (91), Expect(2) = 3e-10 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLAM SKA SDS SR+ Sbjct: 1119 AELFFQMHLLAMLSKAGSDSSSRV 1142 >XP_008237875.1 PREDICTED: tetratricopeptide repeat protein SKI3 [Prunus mume] Length = 1180 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 +VEFCQSP+KWVLRAIHTNPS RY Sbjct: 1147 RVEFCQSPEKWVLRAIHTNPSCMRY 1171 Score = 35.4 bits (80), Expect(2) = 1e-08 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q+KA SDS Sbjct: 1126 AELFFQMHLLARQTKASSDS 1145 >XP_015574671.1 PREDICTED: tetratricopeptide repeat protein SKI3 [Ricinus communis] Length = 1180 Score = 48.5 bits (114), Expect(2) = 6e-08 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRYISFSNELL 169 +E CQSPQKWVLRAIHTNPS RY +L+ Sbjct: 1148 LELCQSPQKWVLRAIHTNPSCLRYWKVLRKLM 1179 Score = 35.4 bits (80), Expect(2) = 6e-08 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QS+A DS S L Sbjct: 1125 AELFFQMHLLARQSEAGFDSSSNL 1148 >EEF52942.1 o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Length = 1236 Score = 48.1 bits (113), Expect(2) = 8e-08 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 +E CQSPQKWVLRAIHTNPS RY Sbjct: 1148 LELCQSPQKWVLRAIHTNPSCLRY 1171 Score = 35.4 bits (80), Expect(2) = 8e-08 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QS+A DS S L Sbjct: 1125 AELFFQMHLLARQSEAGFDSSSNL 1148 >XP_009334757.1 PREDICTED: tetratricopeptide repeat protein SKI3-like isoform X1 [Pyrus x bretschneideri] XP_018498146.1 PREDICTED: tetratricopeptide repeat protein SKI3-like isoform X2 [Pyrus x bretschneideri] Length = 1180 Score = 50.4 bits (119), Expect(2) = 8e-08 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 VEFCQSPQ+WVLRAIHTNPS RY Sbjct: 1148 VEFCQSPQRWVLRAIHTNPSCMRY 1171 Score = 33.1 bits (74), Expect(2) = 8e-08 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFS 71 AELFFQMHLLA QSKA S S Sbjct: 1126 AELFFQMHLLAKQSKASPQSSS 1147 >XP_011464990.1 PREDICTED: tetratricopeptide repeat protein 37 [Fragaria vesca subsp. vesca] Length = 1177 Score = 48.5 bits (114), Expect(2) = 8e-08 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 +EFCQSPQ WVLRAIHTNPS RY Sbjct: 1145 IEFCQSPQGWVLRAIHTNPSCMRY 1168 Score = 35.0 bits (79), Expect(2) = 8e-08 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFS 71 AELFFQMHLLA QSKA +D+ S Sbjct: 1123 AELFFQMHLLAKQSKASTDTSS 1144 >XP_018506530.1 PREDICTED: tetratricopeptide repeat protein SKI3 [Pyrus x bretschneideri] Length = 1169 Score = 50.4 bits (119), Expect(2) = 8e-08 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 VEFCQSPQ+WVLRAIHTNPS RY Sbjct: 1137 VEFCQSPQRWVLRAIHTNPSCMRY 1160 Score = 33.1 bits (74), Expect(2) = 8e-08 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFS 71 AELFFQMHLLA QSKA S S Sbjct: 1115 AELFFQMHLLAKQSKASPQSSS 1136 >XP_018498147.1 PREDICTED: tetratricopeptide repeat protein SKI3-like isoform X3 [Pyrus x bretschneideri] Length = 1137 Score = 50.4 bits (119), Expect(2) = 8e-08 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 VEFCQSPQ+WVLRAIHTNPS RY Sbjct: 1105 VEFCQSPQRWVLRAIHTNPSCMRY 1128 Score = 33.1 bits (74), Expect(2) = 8e-08 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFS 71 AELFFQMHLLA QSKA S S Sbjct: 1083 AELFFQMHLLAKQSKASPQSSS 1104 >XP_012073532.1 PREDICTED: uncharacterized protein LOC105635143 [Jatropha curcas] Length = 1186 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 VEFCQSP KWVLRAIHTNPS RY Sbjct: 1154 VEFCQSPLKWVLRAIHTNPSCVRY 1177 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QS+A DS S + Sbjct: 1131 AELFFQMHLLARQSEAGFDSSSNV 1154 >KDP36716.1 hypothetical protein JCGZ_08007 [Jatropha curcas] Length = 1139 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 VEFCQSP KWVLRAIHTNPS RY Sbjct: 1107 VEFCQSPLKWVLRAIHTNPSCVRY 1130 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QS+A DS S + Sbjct: 1084 AELFFQMHLLARQSEAGFDSSSNV 1107 >ONI05313.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 1178 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 1145 RIEFCQSPEKWVLRAIHTNPSCMRY 1169 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 1125 AELFFQMHLLARQLKASSAS 1144 >ONI05311.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 1177 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 1144 RIEFCQSPEKWVLRAIHTNPSCMRY 1168 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 1124 AELFFQMHLLARQLKASSAS 1143 >ONI05312.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 1172 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 1139 RIEFCQSPEKWVLRAIHTNPSCMRY 1163 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 1119 AELFFQMHLLARQLKASSAS 1138 >ONI05310.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 1171 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 1138 RIEFCQSPEKWVLRAIHTNPSCMRY 1162 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 1118 AELFFQMHLLARQLKASSAS 1137 >ONI05309.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 1038 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 1005 RIEFCQSPEKWVLRAIHTNPSCMRY 1029 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 985 AELFFQMHLLARQLKASSAS 1004 >XP_007210397.1 hypothetical protein PRUPE_ppa000907mg [Prunus persica] ONI05314.1 hypothetical protein PRUPE_5G001100 [Prunus persica] Length = 965 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +2 Query: 71 KVEFCQSPQKWVLRAIHTNPSYFRY 145 ++EFCQSP+KWVLRAIHTNPS RY Sbjct: 932 RIEFCQSPEKWVLRAIHTNPSCMRY 956 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDS 65 AELFFQMHLLA Q KA S S Sbjct: 912 AELFFQMHLLARQLKASSAS 931 >XP_018832964.1 PREDICTED: tetratricopeptide repeat protein SKI3 isoform X1 [Juglans regia] Length = 1180 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 +EFCQSP++WVLRAIHTNPS RY Sbjct: 1150 IEFCQSPERWVLRAIHTNPSCVRY 1173 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QSK+ +S S + Sbjct: 1127 AELFFQMHLLARQSKSAPNSTSNI 1150 >XP_018832966.1 PREDICTED: tetratricopeptide repeat protein SKI3 isoform X2 [Juglans regia] Length = 1169 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 +EFCQSP++WVLRAIHTNPS RY Sbjct: 1139 IEFCQSPERWVLRAIHTNPSCVRY 1162 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QSK+ +S S + Sbjct: 1116 AELFFQMHLLARQSKSAPNSTSNI 1139 >XP_018832967.1 PREDICTED: tetratricopeptide repeat protein SKI3 isoform X3 [Juglans regia] Length = 1010 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +2 Query: 74 VEFCQSPQKWVLRAIHTNPSYFRY 145 +EFCQSP++WVLRAIHTNPS RY Sbjct: 980 IEFCQSPERWVLRAIHTNPSCVRY 1003 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 6 AELFFQMHLLAMQSKAWSDSFSRL 77 AELFFQMHLLA QSK+ +S S + Sbjct: 957 AELFFQMHLLARQSKSAPNSTSNI 980