BLASTX nr result
ID: Phellodendron21_contig00042671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042671 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409647.1 hypothetical protein MELLADRAFT_106085 [Melampsor... 97 3e-21 >XP_007409647.1 hypothetical protein MELLADRAFT_106085 [Melampsora larici-populina 98AG31] EGG07205.1 hypothetical protein MELLADRAFT_106085 [Melampsora larici-populina 98AG31] Length = 404 Score = 97.4 bits (241), Expect = 3e-21 Identities = 45/86 (52%), Positives = 59/86 (68%) Frame = +1 Query: 1 SLYFGITRIWLRSPQFAMPLFGVMSMTRGMGNLIAAPLSSTIRSATVPVEKIRTGFDVDS 180 SL+FG+ R+WLRSP M +G++S+TRG+GN+IA P+SS + S T+P +IRTGFDVDS Sbjct: 319 SLFFGVVRVWLRSPHLTMTTYGIISLTRGLGNIIAGPISSKLISITIPRTEIRTGFDVDS 378 Query: 181 YSGVXXXXXXXXXXXXXXELLLWILQ 258 YS V EL+LWILQ Sbjct: 379 YSKVIWFSGFGLIGTFILELILWILQ 404