BLASTX nr result
ID: Phellodendron21_contig00042617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042617 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008234953.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_004147968.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_002270788.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 XP_006444185.1 hypothetical protein CICLE_v10019759mg [Citrus cl... 70 6e-12 XP_015891647.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 6e-12 XP_015891535.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 6e-12 XP_002524769.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 8e-12 ONH93741.1 hypothetical protein PRUPE_8G249700 [Prunus persica] 69 2e-11 XP_007201156.1 hypothetical protein PRUPE_ppa004264mg [Prunus pe... 69 2e-11 XP_018835395.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 XP_008448953.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 7e-11 XP_007050731.2 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 EOX94888.1 Pentatricopeptide repeat-containing protein, putative... 67 1e-10 OAY61730.1 hypothetical protein MANES_01G212200 [Manihot esculen... 66 2e-10 XP_017699579.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 4e-10 XP_010942480.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 4e-10 XP_010684714.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 6e-10 XP_006294198.1 hypothetical protein CARUB_v10023194mg [Capsella ... 64 8e-10 XP_010070321.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 8e-10 XP_004292613.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 8e-10 >XP_008234953.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Prunus mume] Length = 519 Score = 72.0 bits (175), Expect = 2e-12 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SII+SY +CN VD+L NF+K AE WR SL HCKM M ASQK LEE+ESVL E Sbjct: 410 GVMRSIISSYFRCNKVDRLENFVKRAECARWRTCRSLYHCKMVMYASQKRLEEMESVLNE 469 Query: 319 M 321 M Sbjct: 470 M 470 >XP_004147968.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Cucumis sativus] KGN55949.1 hypothetical protein Csa_3G038710 [Cucumis sativus] Length = 514 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 SII SY +CN VDKL NF+ AES WR+ SL HCKM M ASQ LEE+E VL EM Sbjct: 407 SIIASYFRCNAVDKLINFISRAESSGWRICRSLYHCKMVMFASQNRLEEMECVLDEM 463 >XP_002270788.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] XP_010652090.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] CBI32299.3 unnamed protein product, partial [Vitis vinifera] Length = 494 Score = 71.2 bits (173), Expect = 3e-12 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 SII +Y +CN VD+L NF+K AE W + SL HCKM M ASQK LEE+ESVL EM Sbjct: 389 SIIATYFRCNAVDRLANFVKRAECGGWHICRSLYHCKMVMYASQKRLEEMESVLNEM 445 >XP_006444185.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] XP_006444186.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] XP_006479827.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Citrus sinensis] ESR57425.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] ESR57426.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] KDO87451.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] KDO87452.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] KDO87453.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] Length = 513 Score = 70.5 bits (171), Expect = 6e-12 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = +1 Query: 154 IITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 I++SY +CN VDKL NF+K AES WR+ SL H KM M ASQ+ +EE+ESVLKEM Sbjct: 409 IVSSYFRCNAVDKLANFVKRAESAGWRLCRSLYHSKMVMYASQRRVEEMESVLKEM 464 >XP_015891647.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Ziziphus jujuba] Length = 534 Score = 70.5 bits (171), Expect = 6e-12 Identities = 36/63 (57%), Positives = 42/63 (66%) Frame = +1 Query: 133 SFGLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVL 312 + G+ II SY +CN VD L NF+K AE WR+ SL HCKM M ASQK LEE+E VL Sbjct: 415 TLGVMRCIIASYFRCNAVDGLANFVKRAECAGWRICRSLYHCKMVMYASQKRLEEMERVL 474 Query: 313 KEM 321 EM Sbjct: 475 NEM 477 >XP_015891535.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Ziziphus jujuba] Length = 536 Score = 70.5 bits (171), Expect = 6e-12 Identities = 36/63 (57%), Positives = 42/63 (66%) Frame = +1 Query: 133 SFGLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVL 312 + G+ II SY +CN VD L NF+K AE WR+ SL HCKM M ASQK LEE+E VL Sbjct: 417 TLGVMRCIIASYFRCNAVDGLANFVKRAECAGWRICRSLYHCKMVMYASQKRLEEMERVL 476 Query: 313 KEM 321 EM Sbjct: 477 NEM 479 >XP_002524769.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Ricinus communis] EEF37612.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 509 Score = 70.1 bits (170), Expect = 8e-12 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ +II SY +CN VD+L +F+K AE WR+ SL HCKM M AS+K L+E+ESVL + Sbjct: 400 GIMRTIIASYFRCNAVDRLADFVKRAECSGWRICRSLYHCKMVMYASEKRLDEMESVLND 459 Query: 319 M 321 M Sbjct: 460 M 460 >ONH93741.1 hypothetical protein PRUPE_8G249700 [Prunus persica] Length = 376 Score = 68.9 bits (167), Expect = 2e-11 Identities = 37/61 (60%), Positives = 43/61 (70%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SII+SY +CN VD+L NF+K A WR SL HCKM M ASQK LEE+ESVL E Sbjct: 267 GVMRSIISSYFRCNEVDRLENFVKRAAWARWRTFRSLYHCKMVMYASQKRLEEMESVLNE 326 Query: 319 M 321 M Sbjct: 327 M 327 >XP_007201156.1 hypothetical protein PRUPE_ppa004264mg [Prunus persica] ONH93740.1 hypothetical protein PRUPE_8G249700 [Prunus persica] Length = 519 Score = 68.9 bits (167), Expect = 2e-11 Identities = 37/61 (60%), Positives = 43/61 (70%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SII+SY +CN VD+L NF+K A WR SL HCKM M ASQK LEE+ESVL E Sbjct: 410 GVMRSIISSYFRCNEVDRLENFVKRAAWARWRTFRSLYHCKMVMYASQKRLEEMESVLNE 469 Query: 319 M 321 M Sbjct: 470 M 470 >XP_018835395.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Juglans regia] Length = 512 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SI+ SY +CN VD+L F++ AES WR+ SL HCKM M ASQ+ L+ +ESVL E Sbjct: 403 GVMRSIVASYFRCNAVDRLTKFVRRAESAGWRICRSLYHCKMVMYASQRRLQAMESVLNE 462 Query: 319 M 321 M Sbjct: 463 M 463 >XP_008448953.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Cucumis melo] Length = 514 Score = 67.4 bits (163), Expect = 7e-11 Identities = 34/56 (60%), Positives = 38/56 (67%) Frame = +1 Query: 154 IITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 II SY +CN VDKL NF+ AES WR+ SL HCKM M ASQ EE+E VL EM Sbjct: 408 IIASYFRCNAVDKLINFVSRAESAGWRICRSLYHCKMVMFASQNRFEEMECVLDEM 463 >XP_007050731.2 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Theobroma cacao] XP_017969793.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Theobroma cacao] Length = 529 Score = 66.6 bits (161), Expect = 1e-10 Identities = 35/64 (54%), Positives = 42/64 (65%) Frame = +1 Query: 130 LSFGLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESV 309 L+ L II +Y + N VDKL NF+K AE WR+ SL HCKM M SQK LEE+E+V Sbjct: 417 LTLRLMRCIIAAYFRYNAVDKLANFVKRAECAGWRICRSLYHCKMVMYGSQKRLEEMENV 476 Query: 310 LKEM 321 L EM Sbjct: 477 LNEM 480 >EOX94888.1 Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 529 Score = 66.6 bits (161), Expect = 1e-10 Identities = 35/64 (54%), Positives = 42/64 (65%) Frame = +1 Query: 130 LSFGLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESV 309 L+ L II +Y + N VDKL NF+K AE WR+ SL HCKM M SQK LEE+E+V Sbjct: 417 LTLRLMRCIIAAYFRYNAVDKLANFVKRAECAGWRICRSLYHCKMVMYGSQKRLEEMENV 476 Query: 310 LKEM 321 L EM Sbjct: 477 LNEM 480 >OAY61730.1 hypothetical protein MANES_01G212200 [Manihot esculenta] OAY61731.1 hypothetical protein MANES_01G212200 [Manihot esculenta] Length = 511 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 SIIT Y +CN VD+L F+K AE W++ SL HCKM M ASQK L+E+E VL EM Sbjct: 406 SIITCYFRCNAVDRLAAFVKRAEYAGWKICRSLYHCKMVMYASQKRLDEMERVLDEM 462 >XP_017699579.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Phoenix dactylifera] Length = 360 Score = 65.1 bits (157), Expect = 4e-10 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SII+SY QCN VD+L F+K AE WR+ SL HCKM M Q L+E+ VL E Sbjct: 251 GVMRSIISSYFQCNAVDRLAGFVKQAEYAGWRICRSLYHCKMVMYGKQSRLKEMHEVLDE 310 Query: 319 M 321 M Sbjct: 311 M 311 >XP_010942480.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Elaeis guineensis] Length = 515 Score = 65.1 bits (157), Expect = 4e-10 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = +1 Query: 139 GLPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKE 318 G+ SII+SY QCN VD+L F+K AE WR+ SL HCKM M Q L+E+ VL E Sbjct: 406 GVMRSIISSYFQCNAVDRLAGFVKQAEYAGWRICRSLYHCKMVMYGKQNRLKEMHEVLDE 465 Query: 319 M 321 M Sbjct: 466 M 466 >XP_010684714.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Beta vulgaris subsp. vulgaris] XP_010684715.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Beta vulgaris subsp. vulgaris] XP_010684716.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Beta vulgaris subsp. vulgaris] KMT05835.1 hypothetical protein BVRB_7g165760 [Beta vulgaris subsp. vulgaris] Length = 511 Score = 64.7 bits (156), Expect = 6e-10 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 SIIT+Y N VDKL +F+K AE WR+ SL HCKM M ASQ L+E+E+VL EM Sbjct: 412 SIITAYYHLNAVDKLTSFVKRAECAGWRICRSLYHCKMVMYASQNRLDEMENVLAEM 468 >XP_006294198.1 hypothetical protein CARUB_v10023194mg [Capsella rubella] EOA27096.1 hypothetical protein CARUB_v10023194mg [Capsella rubella] Length = 452 Score = 64.3 bits (155), Expect = 8e-10 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 +IIT+Y +CN VD L NF+K AES W++ SL HCK+ M SQK EE+E V+ EM Sbjct: 356 AIITAYFRCNEVDNLANFVKRAESAGWKLCRSLYHCKIIMYGSQKRFEEMEGVVNEM 412 >XP_010070321.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Eucalyptus grandis] KCW58986.1 hypothetical protein EUGRSUZ_H01610 [Eucalyptus grandis] Length = 514 Score = 64.3 bits (155), Expect = 8e-10 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = +1 Query: 151 SIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 +I+ +Y +CN +DKL NF+K AE WR+ SL HCKM M SQ+ L E+ESVL EM Sbjct: 409 AIVGTYFRCNALDKLVNFVKRAECAGWRICRSLYHCKMVMYGSQQRLAEMESVLDEM 465 >XP_004292613.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Fragaria vesca subsp. vesca] Length = 521 Score = 64.3 bits (155), Expect = 8e-10 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = +1 Query: 142 LPASIITSYSQCNIVDKLCNFLKDAESDWWRV*WSLCHCKMAMCASQKHLEEIESVLKEM 321 L SI+ SY +C VD+L +F+K AE WR+ SL HCKM M AS++ LEE+E+VL EM Sbjct: 413 LMRSIVASYFRCKEVDRLAHFVKRAEGARWRICRSLYHCKMVMYASEQRLEEMENVLGEM 472