BLASTX nr result
ID: Phellodendron21_contig00042442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042442 (917 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO86170.1 hypothetical protein CISIN_1g048762mg [Citrus sinensis] 61 1e-09 >KDO86170.1 hypothetical protein CISIN_1g048762mg [Citrus sinensis] Length = 260 Score = 60.8 bits (146), Expect(3) = 1e-09 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 8/57 (14%) Frame = +1 Query: 691 LLTQLRYCDPNKKQEVIKAGL----KSVADQLGRD----KFKEIFLELSFLPRKIEA 837 L LRYC NK QE IK GL KS++DQLG+D KFKEIFLELS LP+KIEA Sbjct: 180 LQLMLRYCHQNKGQEDIKTGLDGGLKSLSDQLGKDIYEDKFKEIFLELSSLPKKIEA 236 Score = 25.4 bits (54), Expect(3) = 1e-09 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 837 LQNVLCSFFTYEMKTCM 887 LQN L SF T +MK CM Sbjct: 241 LQNELFSFLTEQMKACM 257 Score = 25.0 bits (53), Expect(3) = 1e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 594 ICQKLVVQDTSLQ 632 I QKL+VQDTSLQ Sbjct: 169 ISQKLIVQDTSLQ 181