BLASTX nr result
ID: Phellodendron21_contig00042311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042311 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV99515.1 hypothetical protein PTTG_06820 [Puccinia triticina 1... 67 8e-11 KNE92639.1 hypothetical protein PSTG_13964 [Puccinia striiformis... 63 2e-09 KNZ56585.1 hypothetical protein VP01_2371g7 [Puccinia sorghi] 63 2e-09 XP_003336789.2 hypothetical protein PGTG_18357 [Puccinia gramini... 62 5e-09 >OAV99515.1 hypothetical protein PTTG_06820 [Puccinia triticina 1-1 BBBD Race 1] Length = 476 Score = 66.6 bits (161), Expect = 8e-11 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = +1 Query: 1 QRAFKLAQSCETTDPXXXXXXXXXXXXXYWSPEAAALVRTLENGEGPSKSS 153 QRAFKLAQSC++TDP YWSPEAAALV+TLE GEGPS S+ Sbjct: 9 QRAFKLAQSCQSTDPIKSLKFAKKACALYWSPEAAALVKTLETGEGPSTSA 59 >KNE92639.1 hypothetical protein PSTG_13964 [Puccinia striiformis f. sp. tritici PST-78] Length = 482 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = +1 Query: 1 QRAFKLAQSCETTDPXXXXXXXXXXXXXYWSPEAAALVRTLENGEGPSKSS 153 +RA+KLAQS +TTDP YWSPEAAALV+TLE GEGPS SS Sbjct: 9 KRAYKLAQSYQTTDPTKALKFAKKACALYWSPEAAALVKTLETGEGPSSSS 59 >KNZ56585.1 hypothetical protein VP01_2371g7 [Puccinia sorghi] Length = 525 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +1 Query: 1 QRAFKLAQSCETTDPXXXXXXXXXXXXXYWSPEAAALVRTLENGEGPSKSS 153 QRA KLAQSC+ TDP YWSPEAAALV+TLE GEGPS ++ Sbjct: 89 QRALKLAQSCQATDPIKSLKFARKACALYWSPEAAALVKTLETGEGPSTNN 139 >XP_003336789.2 hypothetical protein PGTG_18357 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP92370.2 hypothetical protein PGTG_18357 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 481 Score = 61.6 bits (148), Expect = 5e-09 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +1 Query: 1 QRAFKLAQSCETTDPXXXXXXXXXXXXXYWSPEAAALVRTLENGEGPSKSS 153 QRAFKLAQS ++TDP YWSPEAAALV+TLE GEGPS ++ Sbjct: 9 QRAFKLAQSLQSTDPIKSLKFAKKACALYWSPEAAALVKTLETGEGPSTTT 59