BLASTX nr result
ID: Phellodendron21_contig00042286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042286 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAK94419.1 hypothetical protein IQ06DRAFT_298454 [Stagonospora s... 70 1e-13 XP_007708033.1 hypothetical protein COCCADRAFT_22796 [Bipolaris ... 64 3e-11 KNG51297.1 mitochondrial carrier protein pet8 protein [Stemphyli... 63 7e-11 XP_007683270.1 hypothetical protein COCMIDRAFT_22316 [Bipolaris ... 63 7e-11 XP_014082386.1 hypothetical protein COCC4DRAFT_37202 [Bipolaris ... 63 7e-11 XP_007702569.1 hypothetical protein COCSADRAFT_39097 [Bipolaris ... 63 7e-11 XP_018379450.1 hypothetical protein CC77DRAFT_578019 [Alternaria... 63 1e-10 XP_001931020.1 conserved hypothetical protein [Pyrenophora triti... 62 2e-10 XP_003305274.1 hypothetical protein PTT_18077 [Pyrenophora teres... 61 2e-10 XP_001797563.1 hypothetical protein SNOG_07214 [Parastagonospora... 60 1e-09 OAL50478.1 hypothetical protein IQ07DRAFT_643739 [Pyrenochaeta s... 59 3e-09 XP_008030531.1 hypothetical protein SETTUDRAFT_157102 [Setosphae... 59 5e-09 XP_018043514.1 hypothetical protein CC84DRAFT_183663 [Paraphaeos... 52 2e-06 KZM22888.1 hypothetical protein ST47_g5993 [Ascochyta rabiei] 51 5e-06 >OAK94419.1 hypothetical protein IQ06DRAFT_298454 [Stagonospora sp. SRC1lsM3a] Length = 103 Score = 70.5 bits (171), Expect = 1e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MSS+RA AARR+P VFTQRAAF QSIA SAGKESTLHSEGR Sbjct: 1 MSSIRALAARRSPLVFTQRAAFSQSIARSAGKESTLHSEGR 41 >XP_007708033.1 hypothetical protein COCCADRAFT_22796 [Bipolaris zeicola 26-R-13] XP_014555354.1 hypothetical protein COCVIDRAFT_38851 [Bipolaris victoriae FI3] EUC37611.1 hypothetical protein COCCADRAFT_22796 [Bipolaris zeicola 26-R-13] EUN25764.1 hypothetical protein COCVIDRAFT_38851 [Bipolaris victoriae FI3] Length = 104 Score = 64.3 bits (155), Expect = 3e-11 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RRTPFVF QRAAF QS SAGKES LHSE R Sbjct: 1 MSAIRAFATRRTPFVFVQRAAFSQSTVRSAGKESALHSENR 41 >KNG51297.1 mitochondrial carrier protein pet8 protein [Stemphylium lycopersici] Length = 104 Score = 63.2 bits (152), Expect = 7e-11 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RR PF F QRAAF QSI AGKES LHSEGR Sbjct: 1 MSAIRAFATRRAPFAFVQRAAFSQSIVRPAGKESALHSEGR 41 >XP_007683270.1 hypothetical protein COCMIDRAFT_22316 [Bipolaris oryzae ATCC 44560] EUC50220.1 hypothetical protein COCMIDRAFT_22316 [Bipolaris oryzae ATCC 44560] Length = 104 Score = 63.2 bits (152), Expect = 7e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RRTPFVF QRAAF QS +AGKES LHSE R Sbjct: 1 MSAIRAFATRRTPFVFAQRAAFSQSTVRAAGKESALHSENR 41 >XP_014082386.1 hypothetical protein COCC4DRAFT_37202 [Bipolaris maydis ATCC 48331] EMD91764.1 hypothetical protein COCHEDRAFT_1156104 [Bipolaris maydis C5] ENI08477.1 hypothetical protein COCC4DRAFT_37202 [Bipolaris maydis ATCC 48331] Length = 104 Score = 63.2 bits (152), Expect = 7e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RRTPFVF QRAAF QS +AGKES LHSE R Sbjct: 1 MSAIRAFATRRTPFVFAQRAAFSQSTVRAAGKESALHSENR 41 >XP_007702569.1 hypothetical protein COCSADRAFT_39097 [Bipolaris sorokiniana ND90Pr] EMD61371.1 hypothetical protein COCSADRAFT_39097 [Bipolaris sorokiniana ND90Pr] Length = 104 Score = 63.2 bits (152), Expect = 7e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RRTPFVF QRAAF QS +AGKES LHSE R Sbjct: 1 MSAIRAFATRRTPFVFAQRAAFSQSTVRAAGKESALHSENR 41 >XP_018379450.1 hypothetical protein CC77DRAFT_578019 [Alternaria alternata] OAG14029.1 hypothetical protein CC77DRAFT_578019 [Alternaria alternata] Length = 102 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RR P F QRAAF QSIA +AGKESTLHSE R Sbjct: 1 MSAIRAFATRRAPIAFVQRAAFSQSIARTAGKESTLHSENR 41 >XP_001931020.1 conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU40125.1 conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 100 Score = 62.0 bits (149), Expect = 2e-10 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS +RAFA RR PFVF QRAAF QSIA GKES LH EGR Sbjct: 1 MSPIRAFATRRAPFVFVQRAAFSQSIARPVGKESALHHEGR 41 >XP_003305274.1 hypothetical protein PTT_18077 [Pyrenophora teres f. teres 0-1] EFQ86649.1 hypothetical protein PTT_18077, partial [Pyrenophora teres f. teres 0-1] Length = 74 Score = 61.2 bits (147), Expect = 2e-10 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RR PFVF QRAAF QSIA KES LH+EGR Sbjct: 1 MSAIRAFATRRAPFVFAQRAAFSQSIARPVSKESALHNEGR 41 >XP_001797563.1 hypothetical protein SNOG_07214 [Parastagonospora nodorum SN15] EAT85865.1 hypothetical protein SNOG_07214 [Parastagonospora nodorum SN15] Length = 103 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS +RA AARRTPFV QRAAF QSIA GKES LH+EGR Sbjct: 1 MSYIRAIAARRTPFVGIQRAAFSQSIARGVGKESALHNEGR 41 >OAL50478.1 hypothetical protein IQ07DRAFT_643739 [Pyrenochaeta sp. DS3sAY3a] Length = 103 Score = 58.9 bits (141), Expect = 3e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MSS+R+ A RR+P +F QRAAF QSIA ++GKESTLHSE R Sbjct: 1 MSSLRSLATRRSPAIFIQRAAFSQSIARASGKESTLHSENR 41 >XP_008030531.1 hypothetical protein SETTUDRAFT_157102 [Setosphaeria turcica Et28A] EOA82275.1 hypothetical protein SETTUDRAFT_157102 [Setosphaeria turcica Et28A] Length = 104 Score = 58.5 bits (140), Expect = 5e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS++RAFA RR P F QRAAF QSIA AGKES LH+E R Sbjct: 1 MSAIRAFATRRAPVAFVQRAAFSQSIARPAGKESALHTENR 41 >XP_018043514.1 hypothetical protein CC84DRAFT_183663 [Paraphaeosphaeria sporulosa] OAG13149.1 hypothetical protein CC84DRAFT_183663 [Paraphaeosphaeria sporulosa] Length = 106 Score = 51.6 bits (122), Expect = 2e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFTQRAAFHQSIAHSAGKESTLHSEGR 2 MS+ RA AARR PF QRA FH S +AGKES LH E R Sbjct: 1 MSAFRALAARRAPFALAQRAPFHASAMRAAGKESHLHDESR 41 >KZM22888.1 hypothetical protein ST47_g5993 [Ascochyta rabiei] Length = 107 Score = 50.8 bits (120), Expect = 5e-06 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = -2 Query: 124 MSSVRAFAARRTPFVFT---QRAAFHQSIAHSAGKESTLHSEGR 2 M SVR+ AARR PFV QRAAF QSI AGKE+ LH+EGR Sbjct: 1 MFSVRSIAARRAPFVSVSTVQRAAFSQSIVRCAGKETKLHTEGR 44