BLASTX nr result
ID: Phellodendron21_contig00042270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042270 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413283.1 hypothetical protein MELLADRAFT_90192 [Melampsora... 82 1e-15 OAV89545.1 hypothetical protein PTTG_04102 [Puccinia triticina 1... 56 1e-06 >XP_007413283.1 hypothetical protein MELLADRAFT_90192 [Melampsora larici-populina 98AG31] EGG03489.1 hypothetical protein MELLADRAFT_90192 [Melampsora larici-populina 98AG31] Length = 627 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = -2 Query: 210 MPSNQSQPDTLHSPPQPASEAIPVPNRTLKWYASIDRLLSPTDEPLSEKVEDRERFYLDL 31 M + P T ++ Q +S P P+RTLKWY +IDR+LSPT EP++ E+RERFYLDL Sbjct: 1 MSTLDQTPPTSNAQTQSSSTLPPNPSRTLKWYVTIDRILSPTGEPIATSEEERERFYLDL 60 Query: 30 FCLKVDSNFL 1 FCLKVDS L Sbjct: 61 FCLKVDSAVL 70 >OAV89545.1 hypothetical protein PTTG_04102 [Puccinia triticina 1-1 BBBD Race 1] Length = 752 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/78 (43%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = -2 Query: 222 PSSTMPSNQSQPDT----LHSPPQPASEAIPVPNRTLKWYASIDRLLSPTDEPLSEKVED 55 P+ST P+ Q T L P PAS R+LKWY+SID+ P D + E Sbjct: 5 PTSTTPATQPDSPTAAASLEQPSTPASS-----RRSLKWYSSIDQAFHPADHLIPP--ES 57 Query: 54 RERFYLDLFCLKVDSNFL 1 RERFYLDL+ LK D L Sbjct: 58 RERFYLDLYLLKPDKEHL 75