BLASTX nr result
ID: Phellodendron21_contig00042200
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042200 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006453676.1 hypothetical protein CICLE_v10009421mg [Citrus cl... 57 2e-07 XP_006473966.1 PREDICTED: DCN1-like protein 4 isoform X1 [Citrus... 57 2e-07 KDO59388.1 hypothetical protein CISIN_1g027440mg [Citrus sinensis] 57 3e-07 KJB56419.1 hypothetical protein B456_009G124900 [Gossypium raimo... 53 2e-06 KNA18558.1 hypothetical protein SOVF_069600 [Spinacia oleracea] 54 2e-06 KHN38022.1 DCN1-like protein 4 [Glycine soja] 54 2e-06 KHN01285.1 DCN1-like protein 4 [Glycine soja] 54 2e-06 XP_019051805.1 PREDICTED: DCN1-like protein 4 isoform X3 [Nelumb... 54 2e-06 GAU11993.1 hypothetical protein TSUD_196180 [Trifolium subterran... 54 3e-06 GAU11994.1 hypothetical protein TSUD_196170 [Trifolium subterran... 54 3e-06 KZV30075.1 hypothetical protein F511_17297 [Dorcoceras hygrometr... 54 3e-06 XP_009380803.1 PREDICTED: DCN1-like protein 4 [Musa acuminata su... 54 3e-06 XP_010245549.1 PREDICTED: DCN1-like protein 4 isoform X2 [Nelumb... 54 3e-06 XP_012067535.1 PREDICTED: DCN1-like protein 4 [Jatropha curcas] ... 54 3e-06 XP_002527318.1 PREDICTED: DCN1-like protein 4 [Ricinus communis]... 54 3e-06 XP_010245547.1 PREDICTED: DCN1-like protein 4 isoform X1 [Nelumb... 54 3e-06 KJB35265.1 hypothetical protein B456_006G107200 [Gossypium raimo... 53 3e-06 KJB35262.1 hypothetical protein B456_006G107200 [Gossypium raimo... 53 3e-06 KJB65737.1 hypothetical protein B456_010G111400 [Gossypium raimo... 54 3e-06 KJB56418.1 hypothetical protein B456_009G124900 [Gossypium raimo... 53 4e-06 >XP_006453676.1 hypothetical protein CICLE_v10009421mg [Citrus clementina] XP_006453677.1 hypothetical protein CICLE_v10009421mg [Citrus clementina] XP_006473967.1 PREDICTED: DCN1-like protein 4 isoform X2 [Citrus sinensis] ESR66916.1 hypothetical protein CICLE_v10009421mg [Citrus clementina] ESR66917.1 hypothetical protein CICLE_v10009421mg [Citrus clementina] KDO59389.1 hypothetical protein CISIN_1g027440mg [Citrus sinensis] KDO59390.1 hypothetical protein CISIN_1g027440mg [Citrus sinensis] Length = 222 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 PDGI TLCKDLE++YTDVRILML WKLKA Sbjct: 49 PDGIVTLCKDLELEYTDVRILMLAWKLKA 77 >XP_006473966.1 PREDICTED: DCN1-like protein 4 isoform X1 [Citrus sinensis] KDO59387.1 hypothetical protein CISIN_1g027440mg [Citrus sinensis] Length = 223 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 PDGI TLCKDLE++YTDVRILML WKLKA Sbjct: 50 PDGIVTLCKDLELEYTDVRILMLAWKLKA 78 >KDO59388.1 hypothetical protein CISIN_1g027440mg [Citrus sinensis] Length = 223 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 241 LSSPDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 + SPDGI TLCKDLE++YTDVRILML W LKA Sbjct: 47 IDSPDGIVTLCKDLELEYTDVRILMLAWYLKA 78 >KJB56419.1 hypothetical protein B456_009G124900 [Gossypium raimondii] Length = 134 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 61 PEGIETLCSDMEVDHTDVRILMLAWKMKA 89 >KNA18558.1 hypothetical protein SOVF_069600 [Spinacia oleracea] Length = 229 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R H+ + Y SS P+GI+TLC D+E+D+TDVR+LML WK+ A Sbjct: 38 RIDHLFYTYANRSSGLIDPEGIETLCSDMEVDHTDVRVLMLAWKMSA 84 >KHN38022.1 DCN1-like protein 4 [Glycine soja] Length = 198 Score = 53.9 bits (128), Expect = 2e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +1 Query: 238 CLSSPDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 C P+GI+TLC D+E+D+TDVR+LML WK+KA Sbjct: 21 CGDCPEGIETLCADMEVDHTDVRVLMLAWKMKA 53 >KHN01285.1 DCN1-like protein 4 [Glycine soja] Length = 198 Score = 53.9 bits (128), Expect = 2e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +1 Query: 238 CLSSPDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 C P+GI+TLC D+E+D+TDVR+LML WK+KA Sbjct: 21 CGDCPEGIETLCADMEVDHTDVRVLMLAWKMKA 53 >XP_019051805.1 PREDICTED: DCN1-like protein 4 isoform X3 [Nelumbo nucifera] Length = 212 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R H+ Y SS P+GI+ LC DLE+D+TDVRILML WK+KA Sbjct: 21 RIDHLFNLYANRSSGMIDPEGIEALCSDLEVDHTDVRILMLAWKMKA 67 >GAU11993.1 hypothetical protein TSUD_196180 [Trifolium subterraneum] Length = 187 Score = 53.5 bits (127), Expect = 3e-06 Identities = 21/29 (72%), Positives = 28/29 (96%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 PDGI++LCKD+++DYTDVRIL+L WK+KA Sbjct: 57 PDGIESLCKDVKVDYTDVRILILAWKMKA 85 >GAU11994.1 hypothetical protein TSUD_196170 [Trifolium subterraneum] Length = 191 Score = 53.5 bits (127), Expect = 3e-06 Identities = 21/29 (72%), Positives = 28/29 (96%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 PDGI++LCKD+++DYTDVRIL+L WK+KA Sbjct: 57 PDGIESLCKDVKVDYTDVRILILAWKMKA 85 >KZV30075.1 hypothetical protein F511_17297 [Dorcoceras hygrometricum] Length = 227 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R H+ + Y SS P+GI++LC DLE+D+TDVRILML WK++A Sbjct: 36 RIDHLFYSYANNSSGLIDPEGIESLCSDLEVDHTDVRILMLAWKMQA 82 >XP_009380803.1 PREDICTED: DCN1-like protein 4 [Musa acuminata subsp. malaccensis] Length = 230 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R ++ + Y SS P+GI++ C DLE+DYTDVRILML WK+KA Sbjct: 39 RIDNLFYAYADASSGLIDPEGIESFCSDLEVDYTDVRILMLAWKMKA 85 >XP_010245549.1 PREDICTED: DCN1-like protein 4 isoform X2 [Nelumbo nucifera] Length = 231 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R H+ Y SS P+GI+ LC DLE+D+TDVRILML WK+KA Sbjct: 40 RIDHLFNLYANRSSGMIDPEGIEALCSDLEVDHTDVRILMLAWKMKA 86 >XP_012067535.1 PREDICTED: DCN1-like protein 4 [Jatropha curcas] XP_012067536.1 PREDICTED: DCN1-like protein 4 [Jatropha curcas] KDP41996.1 hypothetical protein JCGZ_27014 [Jatropha curcas] Length = 231 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R ++ + Y SS P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 40 RIDNLFYSYANRSSGMIDPEGIETLCSDMEVDHTDVRILMLAWKMKA 86 >XP_002527318.1 PREDICTED: DCN1-like protein 4 [Ricinus communis] XP_015579746.1 PREDICTED: DCN1-like protein 4 [Ricinus communis] XP_015579747.1 PREDICTED: DCN1-like protein 4 [Ricinus communis] EEF35070.1 Defective in cullin neddylation protein, putative [Ricinus communis] Length = 231 Score = 53.9 bits (128), Expect = 3e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 241 LSSPDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 L P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 55 LIDPEGIETLCSDMEVDHTDVRILMLAWKMKA 86 >XP_010245547.1 PREDICTED: DCN1-like protein 4 isoform X1 [Nelumbo nucifera] XP_010245548.1 PREDICTED: DCN1-like protein 4 isoform X1 [Nelumbo nucifera] XP_019051804.1 PREDICTED: DCN1-like protein 4 isoform X1 [Nelumbo nucifera] Length = 232 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = +1 Query: 208 RTKHMLFFYVCLSS----PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 R H+ Y SS P+GI+ LC DLE+D+TDVRILML WK+KA Sbjct: 41 RIDHLFNLYANRSSGMIDPEGIEALCSDLEVDHTDVRILMLAWKMKA 87 >KJB35265.1 hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 176 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 59 PEGIETLCSDMEVDHTDVRILMLAWKMKA 87 >KJB35262.1 hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 184 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 21 PEGIETLCSDMEVDHTDVRILMLAWKMKA 49 >KJB65737.1 hypothetical protein B456_010G111400 [Gossypium raimondii] Length = 218 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 PDGI+ LC DL +DYTDVRILML WKLKA Sbjct: 55 PDGIEALCSDLGVDYTDVRILMLAWKLKA 83 >KJB56418.1 hypothetical protein B456_009G124900 [Gossypium raimondii] Length = 189 Score = 53.1 bits (126), Expect = 4e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 250 PDGIKTLCKDLEIDYTDVRILMLTWKLKA 336 P+GI+TLC D+E+D+TDVRILML WK+KA Sbjct: 61 PEGIETLCSDMEVDHTDVRILMLAWKMKA 89