BLASTX nr result
ID: Phellodendron21_contig00042136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00042136 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57336.1 hypothetical protein CISIN_1g010881mg [Citrus sinensis] 227 3e-70 XP_006430418.1 hypothetical protein CICLE_v10011492mg [Citrus cl... 227 6e-70 XP_006481967.1 PREDICTED: pentatricopeptide repeat-containing pr... 227 8e-70 CBI31119.3 unnamed protein product, partial [Vitis vinifera] 198 5e-59 XP_010646695.1 PREDICTED: pentatricopeptide repeat-containing pr... 198 9e-59 GAV69551.1 PPR domain-containing protein/PPR_1 domain-containing... 191 3e-56 XP_010277322.1 PREDICTED: pentatricopeptide repeat-containing pr... 189 3e-55 XP_008227868.1 PREDICTED: pentatricopeptide repeat-containing pr... 187 1e-54 EOY32166.1 Pentatricopeptide repeat protein isoform 2 [Theobroma... 187 1e-54 XP_017982030.1 PREDICTED: pentatricopeptide repeat-containing pr... 187 2e-54 XP_018829934.1 PREDICTED: pentatricopeptide repeat-containing pr... 186 5e-54 XP_007221475.1 hypothetical protein PRUPE_ppa004164mg [Prunus pe... 184 2e-53 XP_017624533.1 PREDICTED: pentatricopeptide repeat-containing pr... 180 7e-52 XP_010062344.1 PREDICTED: pentatricopeptide repeat-containing pr... 180 9e-52 XP_011038349.1 PREDICTED: pentatricopeptide repeat-containing pr... 180 1e-51 NP_001314555.1 pentatricopeptide repeat-containing protein At5g6... 179 3e-51 OMP03653.1 hypothetical protein COLO4_10288 [Corchorus olitorius] 179 3e-51 XP_008343155.1 PREDICTED: pentatricopeptide repeat-containing pr... 176 3e-50 KJB23426.1 hypothetical protein B456_004G097600 [Gossypium raimo... 174 8e-50 XP_012474178.1 PREDICTED: pentatricopeptide repeat-containing pr... 174 2e-49 >KDO57336.1 hypothetical protein CISIN_1g010881mg [Citrus sinensis] Length = 498 Score = 227 bits (579), Expect = 3e-70 Identities = 110/125 (88%), Positives = 117/125 (93%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+EPDNYVLGALLNACRVHGDV+LGKET+ESLV RSLDH GVHVLLSNIYASTEQW Sbjct: 356 VREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQW 415 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 GVEKVR GMED ++RKVPGCSLIEVDGVVCEFVSGER+NVLMEEI LL+FGIDKHLKSL Sbjct: 416 NGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSL 475 Query: 21 CCVDD 7 C DD Sbjct: 476 CFFDD 480 >XP_006430418.1 hypothetical protein CICLE_v10011492mg [Citrus clementina] ESR43658.1 hypothetical protein CICLE_v10011492mg [Citrus clementina] Length = 519 Score = 227 bits (578), Expect = 6e-70 Identities = 109/125 (87%), Positives = 117/125 (93%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+EPDNYVLGALLNACRVHGDV+LGKET+ESLV RSLDH GVHVLLSNIYASTEQW Sbjct: 380 VREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQW 439 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 GVEKVR GMED ++RKVPGCSLIEVDGV+CEFVSGER+NVLMEEI LL+FGIDKHLKSL Sbjct: 440 NGVEKVRRGMEDNEVRKVPGCSLIEVDGVICEFVSGERTNVLMEEIVLLLFGIDKHLKSL 499 Query: 21 CCVDD 7 C DD Sbjct: 500 CFFDD 504 >XP_006481967.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 546 Score = 227 bits (579), Expect = 8e-70 Identities = 110/125 (88%), Positives = 117/125 (93%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+EPDNYVLGALLNACRVHGDV+LGKET+ESLV RSLDH GVHVLLSNIYASTEQW Sbjct: 404 VREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQW 463 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 GVEKVR GMED ++RKVPGCSLIEVDGVVCEFVSGER+NVLMEEI LL+FGIDKHLKSL Sbjct: 464 NGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSL 523 Query: 21 CCVDD 7 C DD Sbjct: 524 CFFDD 528 >CBI31119.3 unnamed protein product, partial [Vitis vinifera] Length = 512 Score = 198 bits (504), Expect = 5e-59 Identities = 96/126 (76%), Positives = 108/126 (85%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+EPD+YVLGALLNACRVHGDVELGKET+E L RSLDHGGVHVLLSN+YAS QW Sbjct: 380 VREMPLEPDSYVLGALLNACRVHGDVELGKETVECLAERSLDHGGVHVLLSNMYASANQW 439 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR GME+KK++KVPGCSLIEVDG V EFV+G+ S+V M+EI LL+ GIDKHLKSL Sbjct: 440 EDVAKVRKGMEEKKVKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKSL 499 Query: 21 CCVDDD 4 DDD Sbjct: 500 WSEDDD 505 >XP_010646695.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] XP_010646696.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] XP_010646698.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] XP_010646699.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] XP_019073850.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] XP_019073851.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 537 Score = 198 bits (504), Expect = 9e-59 Identities = 96/126 (76%), Positives = 108/126 (85%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+EPD+YVLGALLNACRVHGDVELGKET+E L RSLDHGGVHVLLSN+YAS QW Sbjct: 405 VREMPLEPDSYVLGALLNACRVHGDVELGKETVECLAERSLDHGGVHVLLSNMYASANQW 464 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR GME+KK++KVPGCSLIEVDG V EFV+G+ S+V M+EI LL+ GIDKHLKSL Sbjct: 465 EDVAKVRKGMEEKKVKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKSL 524 Query: 21 CCVDDD 4 DDD Sbjct: 525 WSEDDD 530 >GAV69551.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 506 Score = 191 bits (485), Expect = 3e-56 Identities = 89/119 (74%), Positives = 107/119 (89%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VR+MPMEPD+YVLGALLNACRVHG+V+L +ET+E+LV R +DHGGVHVLLSNIYAS++QW Sbjct: 379 VRDMPMEPDSYVLGALLNACRVHGNVDLSEETVENLVERCIDHGGVHVLLSNIYASSKQW 438 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKS 25 V KVR GME+K +RK+PGCS IEVDG VCEFV+G+RS+VLME+ LL+FGIDKHLKS Sbjct: 439 HCVVKVRKGMEEKNVRKIPGCSFIEVDGKVCEFVAGDRSHVLMEDTMLLLFGIDKHLKS 497 >XP_010277322.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] XP_010277323.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] XP_010277325.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] XP_019055707.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 539 Score = 189 bits (480), Expect = 3e-55 Identities = 92/127 (72%), Positives = 109/127 (85%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 V EMPMEPD+YVLGALLNACRVHG+VELGKET+ SL++RSLDHGGVHVLLSNIYAS QW Sbjct: 403 VTEMPMEPDSYVLGALLNACRVHGNVELGKETVGSLMDRSLDHGGVHVLLSNIYASANQW 462 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 VE VR GME+K +RKVPGCSLIEVDGVV EF++G++S+ +ME+I LL+ GI+K LKS Sbjct: 463 EVVEMVRKGMEEKNVRKVPGCSLIEVDGVVHEFIAGDKSHFVMEDIMLLLLGINKQLKSF 522 Query: 21 CCVDDDE 1 DDD+ Sbjct: 523 GFDDDDD 529 >XP_008227868.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 526 Score = 187 bits (476), Expect = 1e-54 Identities = 92/127 (72%), Positives = 104/127 (81%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLNACRVHGDVELGKE +E L +SLDH GVHVLLSNIYAS QW Sbjct: 396 VREMPMEPDSYVLGALLNACRVHGDVELGKEMVERLSGKSLDHSGVHVLLSNIYASANQW 455 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V +R GME+KK+RKVPGCSL+EVDG V EFV+G+RS+VLM+EI L IDKHLKS Sbjct: 456 DDVTVLRKGMEEKKVRKVPGCSLVEVDGEVFEFVAGDRSHVLMDEIMLASLVIDKHLKSR 515 Query: 21 CCVDDDE 1 C DD+ Sbjct: 516 CFDRDDD 522 >EOY32166.1 Pentatricopeptide repeat protein isoform 2 [Theobroma cacao] Length = 511 Score = 187 bits (474), Expect = 1e-54 Identities = 89/126 (70%), Positives = 106/126 (84%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CR+HGDVELGKET+ESLV R LDHGGVHVLLSN+YAS+ QW Sbjct: 378 VREMPMEPDSYVLGALLNSCRMHGDVELGKETVESLVERGLDHGGVHVLLSNMYASSNQW 437 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M +KK+RKVPGCSLIE+DG +CEF+ G+ S +LMEE+ L++ GID HLK L Sbjct: 438 DWVVKVRKEMGEKKVRKVPGCSLIEIDGRLCEFIVGDGSYLLMEEVVLILLGIDNHLKFL 497 Query: 21 CCVDDD 4 DD+ Sbjct: 498 WLDDDN 503 >XP_017982030.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] XP_017982031.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] XP_007014547.2 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] EOY32165.1 Pentatricopeptide repeat protein isoform 1 [Theobroma cacao] Length = 537 Score = 187 bits (474), Expect = 2e-54 Identities = 89/126 (70%), Positives = 106/126 (84%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CR+HGDVELGKET+ESLV R LDHGGVHVLLSN+YAS+ QW Sbjct: 404 VREMPMEPDSYVLGALLNSCRMHGDVELGKETVESLVERGLDHGGVHVLLSNMYASSNQW 463 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M +KK+RKVPGCSLIE+DG +CEF+ G+ S +LMEE+ L++ GID HLK L Sbjct: 464 DWVVKVRKEMGEKKVRKVPGCSLIEIDGRLCEFIVGDGSYLLMEEVVLILLGIDNHLKFL 523 Query: 21 CCVDDD 4 DD+ Sbjct: 524 WLDDDN 529 >XP_018829934.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] XP_018829935.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] XP_018829936.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] XP_018829938.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] XP_018829939.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] Length = 556 Score = 186 bits (473), Expect = 5e-54 Identities = 91/127 (71%), Positives = 106/127 (83%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VR MPMEPD+YVLGALLNACRVHGD ELGKET+E V +SLDHGGVHVLLSN+YAS +W Sbjct: 426 VRAMPMEPDSYVLGALLNACRVHGDFELGKETVEHFVQQSLDHGGVHVLLSNMYASANKW 485 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 KVR GM++KK+RKVPGCSLIEVDGVV EFV+G+RS++LME+I L+ GIDKHLK L Sbjct: 486 DDAAKVRKGMKEKKVRKVPGCSLIEVDGVVSEFVAGDRSHLLMEKITLVSRGIDKHLKFL 545 Query: 21 CCVDDDE 1 DD+ Sbjct: 546 RRDHDDD 552 >XP_007221475.1 hypothetical protein PRUPE_ppa004164mg [Prunus persica] ONI14841.1 hypothetical protein PRUPE_3G011700 [Prunus persica] Length = 526 Score = 184 bits (467), Expect = 2e-53 Identities = 90/127 (70%), Positives = 104/127 (81%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLNACRVHGDVELGKE ++ L +SLDH GVHVLLSNIYAS QW Sbjct: 396 VREMPMEPDSYVLGALLNACRVHGDVELGKEMVKRLSGKSLDHSGVHVLLSNIYASANQW 455 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V +R GME+KK+RKVPGCSL+EV+G V EFV+G+RS+VLM+EI L IDKHLKS Sbjct: 456 DDVTVLRKGMEEKKVRKVPGCSLVEVNGEVFEFVAGDRSHVLMDEIMLASLVIDKHLKSR 515 Query: 21 CCVDDDE 1 C DD+ Sbjct: 516 CFDRDDD 522 >XP_017624533.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium arboreum] Length = 533 Score = 180 bits (457), Expect = 7e-52 Identities = 86/126 (68%), Positives = 103/126 (81%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CRVHGDVELGKET+ESLV R LDHGGVHVLLSN+YAS+ QW Sbjct: 400 VREMPMEPDSYVLGALLNSCRVHGDVELGKETVESLVERGLDHGGVHVLLSNMYASSNQW 459 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M KK+RKVPGCS IE+DG V EF++G+ S + +E++ L++ GID HLK L Sbjct: 460 DWVVKVRKEMGAKKVRKVPGCSSIEIDGSVSEFIAGDMSYLRVEDVMLVLLGIDNHLKCL 519 Query: 21 CCVDDD 4 DD+ Sbjct: 520 FLADDN 525 >XP_010062344.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Eucalyptus grandis] KCW69472.1 hypothetical protein EUGRSUZ_F02927 [Eucalyptus grandis] Length = 532 Score = 180 bits (456), Expect = 9e-52 Identities = 85/120 (70%), Positives = 100/120 (83%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VR MPMEPD+Y LGALLN CRVHGDVELG+E +ES++ R LDHGGVHVLLSNIYAST QW Sbjct: 397 VRGMPMEPDSYALGALLNGCRVHGDVELGREMVESIIQRRLDHGGVHVLLSNIYASTSQW 456 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR GME+ +++KVPGCS IEV+G VCEFV G+RS L+EE+ L+ GI+KHLKSL Sbjct: 457 DDVVKVRKGMEENRVKKVPGCSSIEVNGEVCEFVVGDRSFALIEEVATLLRGIEKHLKSL 516 >XP_011038349.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Populus euphratica] Length = 540 Score = 180 bits (456), Expect = 1e-51 Identities = 86/127 (67%), Positives = 105/127 (82%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMP+ PD+Y LGALL+ACRVHGDV+LG+E +++L R LDHGGVHVLLSN+YAS ++W Sbjct: 404 VREMPLHPDSYTLGALLDACRVHGDVQLGEEMVDTLAQRCLDHGGVHVLLSNMYASADKW 463 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR MEDK IRK+PGCS IEV+G VCEFV+G+RS L E++ L+FGIDKHLKSL Sbjct: 464 EDVSKVRKKMEDKSIRKLPGCSSIEVNGTVCEFVNGDRSCTLKEDMMFLLFGIDKHLKSL 523 Query: 21 CCVDDDE 1 +DDDE Sbjct: 524 -FLDDDE 529 >NP_001314555.1 pentatricopeptide repeat-containing protein At5g66520-like [Gossypium hirsutum] ACP39950.1 pentatricopeptide repeat protein [Gossypium hirsutum] ACP39951.1 pentatricopeptide repeat protein [Gossypium hirsutum] Length = 532 Score = 179 bits (453), Expect = 3e-51 Identities = 85/125 (68%), Positives = 102/125 (81%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CRVHGDVELGKET+ESLV R LDHGGVHVLLSN+YAS+ QW Sbjct: 400 VREMPMEPDSYVLGALLNSCRVHGDVELGKETVESLVERGLDHGGVHVLLSNMYASSNQW 459 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M KK++KVPGCS IE+DG V EF++G+ S + +E++ L++ GID HLK L Sbjct: 460 DWVVKVRKEMGAKKVKKVPGCSSIEIDGSVSEFIAGDMSYLRVEDVMLVLLGIDNHLKFL 519 Query: 21 CCVDD 7 DD Sbjct: 520 LLADD 524 >OMP03653.1 hypothetical protein COLO4_10288 [Corchorus olitorius] Length = 533 Score = 179 bits (453), Expect = 3e-51 Identities = 86/125 (68%), Positives = 102/125 (81%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CRVHGDVELGKET+ESLV + LDH GVHVLLSN+YAS+ QW Sbjct: 404 VREMPMEPDSYVLGALLNSCRVHGDVELGKETVESLVEQGLDHSGVHVLLSNMYASSNQW 463 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 VEKVR M +KK++KVPG S IE+DG VCEF+ G+ S +LMEE+ + + GID HLK L Sbjct: 464 DWVEKVRKEMGEKKVKKVPGYSSIEIDGRVCEFIVGDMSYLLMEELVMFLLGIDNHLKFL 523 Query: 21 CCVDD 7 DD Sbjct: 524 SLDDD 528 >XP_008343155.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Malus domestica] Length = 526 Score = 176 bits (445), Expect = 3e-50 Identities = 87/126 (69%), Positives = 100/126 (79%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLNACRVHGDVELGKE +E L +SLDH GV VLLSNIYAS QW Sbjct: 396 VREMPMEPDSYVLGALLNACRVHGDVELGKEMVERLSGKSLDHSGVRVLLSNIYASANQW 455 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V +R GME+KK+RKVPGCS +EV+ V EFV+G+RS+VLM+EI L+ IDKHLKS Sbjct: 456 DDVTMLRKGMEEKKVRKVPGCSSLEVNXEVFEFVAGDRSHVLMDEITLVSLAIDKHLKSF 515 Query: 21 CCVDDD 4 DD Sbjct: 516 WIDRDD 521 >KJB23426.1 hypothetical protein B456_004G097600 [Gossypium raimondii] Length = 477 Score = 174 bits (440), Expect = 8e-50 Identities = 84/126 (66%), Positives = 101/126 (80%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CRVHGDVELGKET+ESLV R LDHGGV VLLSN+YAS+ QW Sbjct: 344 VREMPMEPDSYVLGALLNSCRVHGDVELGKETVESLVERGLDHGGVLVLLSNMYASSNQW 403 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M KK+ KVPGCS IE+DG V EF++G+ S + +E++ L++ GID HLK L Sbjct: 404 DWVVKVRKEMGAKKVSKVPGCSSIEIDGSVSEFIAGDMSYLRVEDVMLVLLGIDNHLKFL 463 Query: 21 CCVDDD 4 DD+ Sbjct: 464 LLADDN 469 >XP_012474178.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium raimondii] Length = 533 Score = 174 bits (440), Expect = 2e-49 Identities = 84/126 (66%), Positives = 101/126 (80%) Frame = -1 Query: 381 VREMPMEPDNYVLGALLNACRVHGDVELGKETIESLVNRSLDHGGVHVLLSNIYASTEQW 202 VREMPMEPD+YVLGALLN+CRVHGDVELGKET+ESLV R LDHGGV VLLSN+YAS+ QW Sbjct: 400 VREMPMEPDSYVLGALLNSCRVHGDVELGKETVESLVERGLDHGGVLVLLSNMYASSNQW 459 Query: 201 GGVEKVRNGMEDKKIRKVPGCSLIEVDGVVCEFVSGERSNVLMEEIRLLVFGIDKHLKSL 22 V KVR M KK+ KVPGCS IE+DG V EF++G+ S + +E++ L++ GID HLK L Sbjct: 460 DWVVKVRKEMGAKKVSKVPGCSSIEIDGSVSEFIAGDMSYLRVEDVMLVLLGIDNHLKFL 519 Query: 21 CCVDDD 4 DD+ Sbjct: 520 LLADDN 525