BLASTX nr result
ID: Phellodendron21_contig00041991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041991 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF26919.1 conserved hypothetical protein, partial [Ricinus comm... 90 2e-20 >EEF26919.1 conserved hypothetical protein, partial [Ricinus communis] Length = 194 Score = 90.1 bits (222), Expect = 2e-20 Identities = 55/97 (56%), Positives = 59/97 (60%), Gaps = 24/97 (24%) Frame = -2 Query: 311 SHSFRPKEKDGNDCKKRFRNDCKELSSRRMLSSGSICLRDVIS*V--------------- 177 S+SFRPKEKDGNDCK ELSSRRMLSSGSI +R ++ V Sbjct: 106 SNSFRPKEKDGNDCK--------ELSSRRMLSSGSISIRLLLKPVCSVRAYAQFRIHLSA 157 Query: 176 ---------PYRFIHSGTIQLVSK*NSFSIKPFQGYQ 93 PYRFIHSGTIQLVSK NSF IKPFQGYQ Sbjct: 158 GRDLLSPALPYRFIHSGTIQLVSKSNSFYIKPFQGYQ 194