BLASTX nr result
ID: Phellodendron21_contig00041986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041986 (731 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015897704.1 PREDICTED: uncharacterized protein LOC107431332 [... 63 4e-08 KYP33977.1 Retrovirus-related Pol polyprotein from transposon TN... 57 2e-06 KYP63321.1 hypothetical protein KK1_017890 [Cajanus cajan] 54 3e-06 >XP_015897704.1 PREDICTED: uncharacterized protein LOC107431332 [Ziziphus jujuba] Length = 283 Score = 63.2 bits (152), Expect = 4e-08 Identities = 37/82 (45%), Positives = 50/82 (60%) Frame = +1 Query: 418 NAKLEVSVFDGKGDFLTW*KKMRDLLSHHKVLIALEPNEEKWPKLEDHVKAKIREEAYNL 597 + KLE+ VF+GKGDFL W KKMR +L KV A++ + D K +I E A + Sbjct: 2 STKLEIDVFNGKGDFLLWHKKMRAVLVQMKVAKAIDGIYA--ADVTDEKKHEIDEIAIST 59 Query: 598 IFLHLGDSVIRKVDSMNMAIEL 663 I LHL DSV+R+VD M+ +L Sbjct: 60 IILHLSDSVLRQVDDMDTTKDL 81 >KYP33977.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 177 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/84 (38%), Positives = 50/84 (59%) Frame = +1 Query: 412 MANAKLEVSVFDGKGDFLTW*KKMRDLLSHHKVLIALEPNEEKWPKLEDHVKAKIREEAY 591 MA AK+E+ F G GDF W KM LL H + AL ++E K+E+ + ++ ++A+ Sbjct: 1 MAMAKMEIEKFSGLGDFSLWRVKMNALLVHQGLDAAL--SDEAIMKVEERKRTEVLKKAH 58 Query: 592 NLIFLHLGDSVIRKVDSMNMAIEL 663 + I L LGD V+R+V A+E+ Sbjct: 59 SAILLSLGDEVLREVAEEKTAMEI 82 >KYP63321.1 hypothetical protein KK1_017890 [Cajanus cajan] Length = 85 Score = 53.9 bits (128), Expect = 3e-06 Identities = 30/72 (41%), Positives = 43/72 (59%) Frame = +1 Query: 412 MANAKLEVSVFDGKGDFLTW*KKMRDLLSHHKVLIALEPNEEKWPKLEDHVKAKIREEAY 591 MA AK+E+ F G GDF W KM LL H + AL ++E K+E+ + K+ ++AY Sbjct: 1 MAMAKMEIEKFSGLGDFSLWRVKMNALLVHQGLDAAL--SDEAIMKVEERKRTKVLKKAY 58 Query: 592 NLIFLHLGDSVI 627 + I L LGD V+ Sbjct: 59 SAILLSLGDEVL 70