BLASTX nr result
ID: Phellodendron21_contig00041849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041849 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403893.1 hypothetical protein MELLADRAFT_76387 [Melampsora... 57 3e-07 >XP_007403893.1 hypothetical protein MELLADRAFT_76387 [Melampsora larici-populina 98AG31] EGG12955.1 hypothetical protein MELLADRAFT_76387 [Melampsora larici-populina 98AG31] Length = 448 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -2 Query: 156 VFVAMFIISCEAGKLPHSVMLHRRATFNFLAAPKPQNFSDDSLEDYDQFHFR 1 +++A + EA LP SV LHRR F F+A PQ++S DSLEDYDQ+HFR Sbjct: 12 IWIAALTLPSEARTLPTSVKLHRR--FTFVAHAPPQDWSTDSLEDYDQYHFR 61