BLASTX nr result
ID: Phellodendron21_contig00041829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041829 (603 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO81773.1 hypothetical protein CISIN_1g039463mg [Citrus sinensis] 56 4e-07 >KDO81773.1 hypothetical protein CISIN_1g039463mg [Citrus sinensis] Length = 89 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = -3 Query: 136 MFVDSEVTVTNKCLDVDGPPSQELLHLGRSHIPLPWGXXXXX*PF 2 MFVDS+VTV K VDGPP ELLHLG+SHIP P G PF Sbjct: 1 MFVDSKVTVRKKRSFVDGPPLLELLHLGKSHIPSPCGAALLPLPF 45