BLASTX nr result
ID: Phellodendron21_contig00041729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041729 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO84876.1 Vacuolar sorting protein 9 [Corchorus olitorius] 55 1e-06 OMO72832.1 Glycosyl transferase, family 31 [Corchorus capsularis] 55 1e-06 KDO80822.1 hypothetical protein CISIN_1g0118121mg, partial [Citr... 53 2e-06 XP_007018922.2 PREDICTED: vacuolar protein sorting-associated pr... 55 2e-06 XP_016703212.1 PREDICTED: vacuolar protein sorting-associated pr... 55 2e-06 XP_016754373.1 PREDICTED: vacuolar protein sorting-associated pr... 55 2e-06 XP_012451314.1 PREDICTED: vacuolar protein sorting-associated pr... 55 2e-06 XP_017646462.1 PREDICTED: vacuolar protein sorting-associated pr... 55 2e-06 EOY16146.1 Vacuolar sorting protein 9 domain isoform 1 [Theobrom... 55 2e-06 XP_008338874.1 PREDICTED: vacuolar protein sorting-associated pr... 54 2e-06 XP_008233931.1 PREDICTED: vacuolar protein sorting-associated pr... 54 4e-06 XP_007222254.1 hypothetical protein PRUPE_ppa004752mg [Prunus pe... 54 4e-06 XP_014501966.1 PREDICTED: vacuolar protein sorting-associated pr... 54 5e-06 XP_017422234.1 PREDICTED: vacuolar protein sorting-associated pr... 54 5e-06 XP_007136193.1 hypothetical protein PHAVU_009G026000g [Phaseolus... 54 5e-06 XP_009367011.1 PREDICTED: vacuolar protein sorting-associated pr... 54 5e-06 XP_009367322.1 PREDICTED: vacuolar protein sorting-associated pr... 53 7e-06 XP_008378527.1 PREDICTED: vacuolar protein sorting-associated pr... 53 7e-06 XP_006472696.1 PREDICTED: vacuolar protein sorting-associated pr... 53 7e-06 XP_006434098.1 hypothetical protein CICLE_v10001011mg [Citrus cl... 53 7e-06 >OMO84876.1 Vacuolar sorting protein 9 [Corchorus olitorius] Length = 537 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 241 GD*MENADVFLGLQDFLERMHQPSAADFVK 330 G MENADVFLGLQDFLERM QPSAADFVK Sbjct: 31 GGGMENADVFLGLQDFLERMRQPSAADFVK 60 >OMO72832.1 Glycosyl transferase, family 31 [Corchorus capsularis] Length = 883 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 241 GD*MENADVFLGLQDFLERMHQPSAADFVK 330 G MENADVFLGLQDFLERM QPSAADFVK Sbjct: 394 GGGMENADVFLGLQDFLERMRQPSAADFVK 423 >KDO80822.1 hypothetical protein CISIN_1g0118121mg, partial [Citrus sinensis] Length = 137 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGL DFLERM QPSAADFVK Sbjct: 1 MENADVFLGLHDFLERMRQPSAADFVK 27 >XP_007018922.2 PREDICTED: vacuolar protein sorting-associated protein 9A [Theobroma cacao] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >XP_016703212.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Gossypium hirsutum] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >XP_016754373.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Gossypium hirsutum] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >XP_012451314.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Gossypium raimondii] KJB64382.1 hypothetical protein B456_010G046700 [Gossypium raimondii] KJB64383.1 hypothetical protein B456_010G046700 [Gossypium raimondii] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >XP_017646462.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Gossypium arboreum] KHG03201.1 Vacuolar sorting-associated protein 9A -like protein [Gossypium arboreum] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >EOY16146.1 Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao] EOY16147.1 Vacuolar sorting protein 9 domain isoform 1 [Theobroma cacao] Length = 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAADFVK 27 >XP_008338874.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Malus domestica] Length = 182 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MEN DVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENTDVFLGLQDFLERMRQPSAADFVK 27 >XP_008233931.1 PREDICTED: vacuolar protein sorting-associated protein 9A [Prunus mume] Length = 492 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QP+AADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPTAADFVK 27 >XP_007222254.1 hypothetical protein PRUPE_ppa004752mg [Prunus persica] ONI34926.1 hypothetical protein PRUPE_1G506400 [Prunus persica] Length = 493 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QP+AADFVK Sbjct: 1 MENADVFLGLQDFLERMRQPTAADFVK 27 >XP_014501966.1 PREDICTED: vacuolar protein sorting-associated protein 9A [Vigna radiata var. radiata] Length = 470 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAA+FVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAAEFVK 27 >XP_017422234.1 PREDICTED: vacuolar protein sorting-associated protein 9A [Vigna angularis] KOM41641.1 hypothetical protein LR48_Vigan04g183900 [Vigna angularis] BAT78574.1 hypothetical protein VIGAN_02126900 [Vigna angularis var. angularis] Length = 470 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAA+FVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAAEFVK 27 >XP_007136193.1 hypothetical protein PHAVU_009G026000g [Phaseolus vulgaris] ESW08187.1 hypothetical protein PHAVU_009G026000g [Phaseolus vulgaris] Length = 471 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGLQDFLERM QPSAA+FVK Sbjct: 1 MENADVFLGLQDFLERMRQPSAAEFVK 27 >XP_009367011.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Pyrus x bretschneideri] Length = 476 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MEN DVFLGLQDFLERM QPSAADFVK Sbjct: 1 MENTDVFLGLQDFLERMRQPSAADFVK 27 >XP_009367322.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Pyrus x bretschneideri] Length = 474 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGL DFLERM QPSAADFVK Sbjct: 1 MENADVFLGLHDFLERMRQPSAADFVK 27 >XP_008378527.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Malus domestica] Length = 474 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGL DFLERM QPSAADFVK Sbjct: 1 MENADVFLGLHDFLERMRQPSAADFVK 27 >XP_006472696.1 PREDICTED: vacuolar protein sorting-associated protein 9A-like [Citrus sinensis] Length = 477 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGL DFLERM QPSAADFVK Sbjct: 1 MENADVFLGLHDFLERMRQPSAADFVK 27 >XP_006434098.1 hypothetical protein CICLE_v10001011mg [Citrus clementina] ESR47338.1 hypothetical protein CICLE_v10001011mg [Citrus clementina] Length = 477 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 250 MENADVFLGLQDFLERMHQPSAADFVK 330 MENADVFLGL DFLERM QPSAADFVK Sbjct: 1 MENADVFLGLHDFLERMRQPSAADFVK 27