BLASTX nr result
ID: Phellodendron21_contig00041714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041714 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO43853.1 hypothetical protein CISIN_1g0409871mg, partial [Citr... 57 2e-08 XP_002533224.1 PREDICTED: WD repeat-containing protein 75 [Ricin... 61 3e-08 XP_018850745.1 PREDICTED: WD repeat-containing protein 75 [Jugla... 59 1e-07 XP_010094219.1 WD repeat-containing protein 75 [Morus notabilis]... 59 2e-07 GAV59567.1 WD40 domain-containing protein [Cephalotus follicularis] 58 2e-07 XP_016750000.1 PREDICTED: WD repeat-containing protein 75-like [... 58 3e-07 APR64195.1 transducin family protein-like 4 [Populus tomentosa] 58 3e-07 XP_011043947.1 PREDICTED: WD repeat-containing protein 75-like [... 58 3e-07 XP_002324467.1 transducin family protein [Populus trichocarpa] E... 58 3e-07 XP_017646265.1 PREDICTED: WD repeat-containing protein 75 [Gossy... 58 3e-07 XP_006474199.1 PREDICTED: WD repeat-containing protein 75 [Citru... 57 6e-07 XP_006453344.1 hypothetical protein CICLE_v10007405mg [Citrus cl... 57 6e-07 KJB53782.1 hypothetical protein B456_009G004800 [Gossypium raimo... 57 8e-07 XP_016690381.1 PREDICTED: WD repeat-containing protein 75 [Gossy... 57 8e-07 XP_012442329.1 PREDICTED: WD repeat-containing protein 75 [Gossy... 57 8e-07 OAY46735.1 hypothetical protein MANES_06G023100 [Manihot esculenta] 56 1e-06 ONI27408.1 hypothetical protein PRUPE_1G084200 [Prunus persica] 55 2e-06 XP_008223768.1 PREDICTED: WD repeat-containing protein 75 [Prunu... 55 2e-06 OMO71724.1 hypothetical protein CCACVL1_18085 [Corchorus capsula... 55 3e-06 OMO51290.1 hypothetical protein COLO4_37741 [Corchorus olitorius] 55 3e-06 >KDO43853.1 hypothetical protein CISIN_1g0409871mg, partial [Citrus sinensis] Length = 67 Score = 57.0 bits (136), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ +E Sbjct: 38 SGSSHNLPPLTKLCSAFLESLLEKRTAALE 67 >XP_002533224.1 PREDICTED: WD repeat-containing protein 75 [Ricinus communis] EEF29164.1 wd40 protein, putative [Ricinus communis] Length = 807 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RTSVVE Sbjct: 778 SGSSHNLPPLTKLCSAFLESLLEKRTSVVE 807 >XP_018850745.1 PREDICTED: WD repeat-containing protein 75 [Juglans regia] Length = 813 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESL+E+RT+VVE Sbjct: 784 SGSSHNLPPLTKLCSAFLESLMEKRTAVVE 813 >XP_010094219.1 WD repeat-containing protein 75 [Morus notabilis] EXB55395.1 WD repeat-containing protein 75 [Morus notabilis] Length = 815 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLERRT VE Sbjct: 786 SGSSHNLPPLTKLCSAFLESLLERRTPTVE 815 >GAV59567.1 WD40 domain-containing protein [Cephalotus follicularis] Length = 811 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCS+FLESLLE+RT VVE Sbjct: 782 SGSSHNLPPLTKLCSSFLESLLEKRTDVVE 811 >XP_016750000.1 PREDICTED: WD repeat-containing protein 75-like [Gossypium hirsutum] Length = 723 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RTS E Sbjct: 694 SGSSHNLPPLTKLCSAFLESLLEKRTSAAE 723 >APR64195.1 transducin family protein-like 4 [Populus tomentosa] Length = 811 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESL E+RT++VE Sbjct: 782 SGSSHNLPPLTKLCSAFLESLFEKRTAIVE 811 >XP_011043947.1 PREDICTED: WD repeat-containing protein 75-like [Populus euphratica] Length = 811 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESL E+RT++VE Sbjct: 782 SGSSHNLPPLTKLCSAFLESLFEKRTAIVE 811 >XP_002324467.1 transducin family protein [Populus trichocarpa] EEF03032.1 transducin family protein [Populus trichocarpa] Length = 811 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESL E+RT++VE Sbjct: 782 SGSSHNLPPLTKLCSAFLESLFEKRTAIVE 811 >XP_017646265.1 PREDICTED: WD repeat-containing protein 75 [Gossypium arboreum] KHG06564.1 WD repeat-containing 75 [Gossypium arboreum] Length = 812 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RTS E Sbjct: 783 SGSSHNLPPLTKLCSAFLESLLEKRTSAAE 812 >XP_006474199.1 PREDICTED: WD repeat-containing protein 75 [Citrus sinensis] Length = 818 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ +E Sbjct: 789 SGSSHNLPPLTKLCSAFLESLLEKRTAALE 818 >XP_006453344.1 hypothetical protein CICLE_v10007405mg [Citrus clementina] ESR66584.1 hypothetical protein CICLE_v10007405mg [Citrus clementina] Length = 888 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ +E Sbjct: 859 SGSSHNLPPLTKLCSAFLESLLEKRTAALE 888 >KJB53782.1 hypothetical protein B456_009G004800 [Gossypium raimondii] Length = 797 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ E Sbjct: 768 SGSSHNLPPLTKLCSAFLESLLEKRTAAAE 797 >XP_016690381.1 PREDICTED: WD repeat-containing protein 75 [Gossypium hirsutum] Length = 812 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ E Sbjct: 783 SGSSHNLPPLTKLCSAFLESLLEKRTAAAE 812 >XP_012442329.1 PREDICTED: WD repeat-containing protein 75 [Gossypium raimondii] KJB53781.1 hypothetical protein B456_009G004800 [Gossypium raimondii] Length = 812 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSAFLESLLE+RT+ E Sbjct: 783 SGSSHNLPPLTKLCSAFLESLLEKRTAAAE 812 >OAY46735.1 hypothetical protein MANES_06G023100 [Manihot esculenta] Length = 815 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCSA LESLLE+RT+V E Sbjct: 786 SGSSHNLPPLTKLCSAILESLLEKRTTVAE 815 >ONI27408.1 hypothetical protein PRUPE_1G084200 [Prunus persica] Length = 812 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCS F+ESLLE+RT+ VE Sbjct: 783 SGSSHNLPPLTKLCSEFMESLLEKRTATVE 812 >XP_008223768.1 PREDICTED: WD repeat-containing protein 75 [Prunus mume] Length = 812 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSHNLPPLTKLCS F+ESLLE+RT+ VE Sbjct: 783 SGSSHNLPPLTKLCSEFMESLLEKRTATVE 812 >OMO71724.1 hypothetical protein CCACVL1_18085 [Corchorus capsularis] Length = 789 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSH LPPLTKLCSAFLESLLE+RT+ VE Sbjct: 760 SGSSHALPPLTKLCSAFLESLLEKRTAAVE 789 >OMO51290.1 hypothetical protein COLO4_37741 [Corchorus olitorius] Length = 805 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 SGSSHNLPPLTKLCSAFLESLLERRTSVVE 284 SGSSH LPPLTKLCSAFLESLLE+RT+ VE Sbjct: 776 SGSSHALPPLTKLCSAFLESLLEKRTAAVE 805