BLASTX nr result
ID: Phellodendron21_contig00041703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041703 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO72828.1 hypothetical protein CISIN_1g045051mg [Citrus sinensis] 58 8e-08 XP_006424858.1 hypothetical protein CICLE_v10027926mg [Citrus cl... 58 8e-08 >KDO72828.1 hypothetical protein CISIN_1g045051mg [Citrus sinensis] Length = 700 Score = 58.2 bits (139), Expect = 8e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 176 MNTPLEELSSSMKNHLQFDPGSVSVYSNQNHVDKFKL 286 M T +EE S SMKN LQFD GSVS YSN+NHVDKFKL Sbjct: 1 MKTLVEEFSGSMKNPLQFDRGSVSTYSNRNHVDKFKL 37 >XP_006424858.1 hypothetical protein CICLE_v10027926mg [Citrus clementina] XP_006488350.1 PREDICTED: scarecrow-like protein 30 [Citrus sinensis] ESR38098.1 hypothetical protein CICLE_v10027926mg [Citrus clementina] Length = 700 Score = 58.2 bits (139), Expect = 8e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 176 MNTPLEELSSSMKNHLQFDPGSVSVYSNQNHVDKFKL 286 M T +EE S SMKN LQFD GSVS YSN+NHVDKFKL Sbjct: 1 MKTLVEEFSGSMKNPLQFDRGSVSTYSNRNHVDKFKL 37