BLASTX nr result
ID: Phellodendron21_contig00041623
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041623 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003328018.2 hypothetical protein PGTG_09312 [Puccinia gramini... 60 5e-09 OAV98261.1 hypothetical protein PTTG_25721 [Puccinia triticina 1... 59 9e-09 >XP_003328018.2 hypothetical protein PGTG_09312 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP83599.2 hypothetical protein PGTG_09312 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 95 Score = 59.7 bits (143), Expect = 5e-09 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = +2 Query: 110 ERARRITSLHIQALHEYNACKDYTQRLLAAIRSIEGTTVKEIYERFDL 253 +RA+++T+ HI AL +YN CK++TQ L+ AI S+EG T+ E++ERF L Sbjct: 44 QRAKQLTASHIAALDKYNTCKEHTQSLMKAIASVEGKTLTEVFERFGL 91 >OAV98261.1 hypothetical protein PTTG_25721 [Puccinia triticina 1-1 BBBD Race 1] Length = 95 Score = 58.9 bits (141), Expect = 9e-09 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = +2 Query: 110 ERARRITSLHIQALHEYNACKDYTQRLLAAIRSIEGTTVKEIYERFDL 253 +RA+++T+ HI AL +YN CK++TQ ++ AI SIEG T+ E++ERF L Sbjct: 44 QRAKQLTASHIAALDKYNTCKEHTQSIIKAIASIEGKTLGEVFERFGL 91