BLASTX nr result
ID: Phellodendron21_contig00041621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041621 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007407971.1 hypothetical protein MELLADRAFT_115872 [Melampsor... 80 4e-15 >XP_007407971.1 hypothetical protein MELLADRAFT_115872 [Melampsora larici-populina 98AG31] EGG08997.1 hypothetical protein MELLADRAFT_115872 [Melampsora larici-populina 98AG31] Length = 416 Score = 79.7 bits (195), Expect = 4e-15 Identities = 44/88 (50%), Positives = 58/88 (65%) Frame = +1 Query: 25 RHKRPKAKEKSDLHTLQINLAIQRVSRAAKKAKTFELQNLVRKIKRIRDSKTPPQANSTP 204 ++K+ K + S+ + QIN AI+ VSRA KKAKTFE+Q+ +RKIK I+D P S Sbjct: 45 KNKQSKLETNSESPSHQINKAIKNVSRAVKKAKTFEVQHFLRKIKSIKD----PNPKSRV 100 Query: 205 DPSHLPLLESQFKELKAIDPPGFACRIV 288 DPS LP LES +L+AIDP FA I+ Sbjct: 101 DPSQLPELESDLHDLRAIDPTSFATLII 128