BLASTX nr result
ID: Phellodendron21_contig00041602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041602 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413221.1 hypothetical protein MELLADRAFT_78558 [Melampsora... 84 2e-16 >XP_007413221.1 hypothetical protein MELLADRAFT_78558 [Melampsora larici-populina 98AG31] EGG03427.1 hypothetical protein MELLADRAFT_78558 [Melampsora larici-populina 98AG31] Length = 534 Score = 84.3 bits (207), Expect = 2e-16 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 1/116 (0%) Frame = +1 Query: 25 PEFEDEDE-IFQAHELNAIRAVVELRQKELGDRQSSRLEXXXXXXXXXXXXXHSVQQKFT 201 PE E+E+E +FQ +EL+ IRAVV+ R + SS L+ ++ ++ FT Sbjct: 156 PEIEEEEENVFQFNELDVIRAVVDYRHYQSSKPNSSGLDSKTNR--------YTGKENFT 207 Query: 202 RSKSIKEWLETWSAREAXXXXXXXXXXXXXSNKLSDRSSQILTHHSKLLSSPRKPS 369 R++S K+ +ETW+AREA +N+ S++ SQILTHH+KLLSSPRKP+ Sbjct: 208 RNESTKQQIETWAAREAQIQIIFLLEIIVLTNQSSNQGSQILTHHTKLLSSPRKPN 263