BLASTX nr result
ID: Phellodendron21_contig00041581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041581 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006424986.1 hypothetical protein CICLE_v10029721mg [Citrus cl... 70 3e-14 >XP_006424986.1 hypothetical protein CICLE_v10029721mg [Citrus clementina] ESR38226.1 hypothetical protein CICLE_v10029721mg [Citrus clementina] Length = 79 Score = 70.5 bits (171), Expect = 3e-14 Identities = 42/82 (51%), Positives = 49/82 (59%), Gaps = 4/82 (4%) Frame = -3 Query: 234 IFSIRPVVLRQSGQHKGLKFSGKVYSIVLFRW*DCVQYKDXXXXXXXXXXXXXXXXFTCW 55 +FSIRPV+LRQSGQHKGL+FSGKVYSI+LFR+ V C Sbjct: 1 MFSIRPVLLRQSGQHKGLRFSGKVYSIILFRFGKIV-----------FNVRILFVVKFCL 49 Query: 54 EIL----FLVSH*FELFNYTLP 1 +L FL+SH FELFNY LP Sbjct: 50 LVLIFLEFLISHWFELFNYNLP 71