BLASTX nr result
ID: Phellodendron21_contig00041572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041572 (621 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO76948.1 hypothetical protein CISIN_1g033566mg [Citrus sinensis] 89 2e-20 >KDO76948.1 hypothetical protein CISIN_1g033566mg [Citrus sinensis] Length = 116 Score = 89.4 bits (220), Expect(2) = 2e-20 Identities = 47/72 (65%), Positives = 55/72 (76%) Frame = +2 Query: 305 QL*IQLNLAILERVNKFNNTH*FCKGQRCSYIASNRQFTSHNLFSPPTTPLSYNSARNPT 484 QL QLNLAILE+V KFNNTH C +R S A+ RQ TSH LFS PTT +SY+SA+NPT Sbjct: 6 QLESQLNLAILEQVYKFNNTHYSCTTKRSSNTAAIRQVTSHILFSTPTTLMSYDSAKNPT 65 Query: 485 KFLKFSNPRVSK 520 K+LKF+N R SK Sbjct: 66 KYLKFTNHRASK 77 Score = 37.4 bits (85), Expect(2) = 2e-20 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +1 Query: 526 QYPLLQNTSTTQRSSNKDQI*PFSAKMVLKKK 621 Q+ L QNTST +RSSNK QI PF A + KK+ Sbjct: 81 QHQLHQNTSTAERSSNKHQILPFPALTIGKKQ 112