BLASTX nr result
ID: Phellodendron21_contig00041553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041553 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007407302.1 hypothetical protein MELLADRAFT_115746 [Melampsor... 84 5e-16 OAV98830.1 hypothetical protein PTTG_12288 [Puccinia triticina 1... 55 7e-06 >XP_007407302.1 hypothetical protein MELLADRAFT_115746 [Melampsora larici-populina 98AG31] EGG09575.1 hypothetical protein MELLADRAFT_115746 [Melampsora larici-populina 98AG31] Length = 465 Score = 84.3 bits (207), Expect = 5e-16 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 1 GNASGGHFNPRFMGGGGPHGIGAQNGMGGMDDGREKRRRTEY 126 GNA+GGHFNPRFM G G HG GAQNGMGGMDDGREKRRRT+Y Sbjct: 424 GNANGGHFNPRFMNGAGSHGAGAQNGMGGMDDGREKRRRTDY 465 >OAV98830.1 hypothetical protein PTTG_12288 [Puccinia triticina 1-1 BBBD Race 1] Length = 511 Score = 55.1 bits (131), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 13/55 (23%) Frame = +1 Query: 1 GNASGGHFNPRFMGG-----GGPH--------GIGAQNGMGGMDDGREKRRRTEY 126 G + GHFNPRF+ G GGP G+G G G +DDGREKRRRTEY Sbjct: 457 GGPNNGHFNPRFIAGVNHSMGGPQASLGGTGSGVGGTGGGGNLDDGREKRRRTEY 511