BLASTX nr result
ID: Phellodendron21_contig00041532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041532 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015382226.1 PREDICTED: uncharacterized protein LOC107175329, ... 48 5e-06 >XP_015382226.1 PREDICTED: uncharacterized protein LOC107175329, partial [Citrus sinensis] Length = 781 Score = 47.8 bits (112), Expect(3) = 5e-06 Identities = 24/47 (51%), Positives = 30/47 (63%) Frame = +1 Query: 100 LKEMEIF*GLGLPEKIKIFIWYAISNLLPTTLNLARNQVVKSVIRTR 240 L + + LPEKIKIF+W A+ NLLPTT NL R ++V S I R Sbjct: 646 LSQWNVIWAAELPEKIKIFMWRAVKNLLPTTSNLWRRKIVGSPICRR 692 Score = 28.1 bits (61), Expect(3) = 5e-06 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 3 WHYDKKRSFSIKSAYHL 53 WHYDK +S+KS Y + Sbjct: 613 WHYDKYGKYSVKSGYQI 629 Score = 20.8 bits (42), Expect(3) = 5e-06 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 239 ESVLHALIFCKCSWK 283 E V+HAL+ CK + K Sbjct: 698 EDVIHALLDCKVAKK 712