BLASTX nr result
ID: Phellodendron21_contig00041531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041531 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO55501.1 hypothetical protein CISIN_1g0449881mg, partial [Citr... 99 8e-22 OAY31069.1 hypothetical protein MANES_14G081300 [Manihot esculenta] 100 2e-21 XP_006477483.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 3e-21 XP_017972409.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 2e-20 EOY21925.1 Tetratricopeptide repeat-like superfamily protein, pu... 97 2e-20 XP_006440636.1 hypothetical protein CICLE_v10019550mg [Citrus cl... 97 3e-20 XP_015883424.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 6e-20 XP_012080303.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 3e-18 CAN66661.1 hypothetical protein VITISV_031721, partial [Vitis vi... 89 2e-17 CBI15196.3 unnamed protein product, partial [Vitis vinifera] 88 2e-17 XP_010030169.2 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-17 XP_002281803.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 3e-17 OMO52853.1 hypothetical protein COLO4_36936 [Corchorus olitorius] 87 8e-17 XP_010089898.1 hypothetical protein L484_008586 [Morus notabilis... 85 5e-16 XP_009339140.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 1e-15 XP_008374571.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 4e-15 XP_018826514.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 5e-15 XP_017637874.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 1e-14 XP_016741753.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 1e-14 XP_008239983.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-14 >KDO55501.1 hypothetical protein CISIN_1g0449881mg, partial [Citrus sinensis] Length = 343 Score = 99.4 bits (246), Expect = 8e-22 Identities = 47/62 (75%), Positives = 52/62 (83%) Frame = +1 Query: 91 MCARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRN 270 +CARCGLFREGEQVHGRVLASGYCSNVFIR NL+NLY M GGE GV A +FD+M R+ Sbjct: 127 VCARCGLFREGEQVHGRVLASGYCSNVFIRTNLMNLYLMSGGECGVGCARLLFDDMPARS 186 Query: 271 VV 276 VV Sbjct: 187 VV 188 >OAY31069.1 hypothetical protein MANES_14G081300 [Manihot esculenta] Length = 554 Score = 100 bits (248), Expect = 2e-21 Identities = 47/62 (75%), Positives = 51/62 (82%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR GL REGEQVHGRVL +GYCSNVF++ NLVNLYAM G SGV YA RVFD+M RNV Sbjct: 127 CARSGLLREGEQVHGRVLVTGYCSNVFVQTNLVNLYAMAGAHSGVGYARRVFDDMGDRNV 186 Query: 274 VC 279 VC Sbjct: 187 VC 188 >XP_006477483.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 556 Score = 99.4 bits (246), Expect = 3e-21 Identities = 47/62 (75%), Positives = 52/62 (83%) Frame = +1 Query: 91 MCARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRN 270 +CARCGLFREGEQVHGRVLASGYCSNVFIR NL+NLY M GGE GV A +FD+M R+ Sbjct: 127 VCARCGLFREGEQVHGRVLASGYCSNVFIRTNLMNLYLMSGGECGVGCARLLFDDMPARS 186 Query: 271 VV 276 VV Sbjct: 187 VV 188 >XP_017972409.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] Length = 551 Score = 97.4 bits (241), Expect = 2e-20 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR G+ REGEQVHG+VLA GYCSNVF+R NLVNLYAM GG G+ YA RVFDEM RNV Sbjct: 127 CARSGMLREGEQVHGKVLADGYCSNVFVRTNLVNLYAMVGGGDGIGYARRVFDEMGERNV 186 Query: 274 V 276 V Sbjct: 187 V 187 >EOY21925.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 551 Score = 97.4 bits (241), Expect = 2e-20 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR G+ REGEQVHG+VLA GYCSNVF+R NLVNLYAM GG G+ YA RVFDEM RNV Sbjct: 127 CARSGMLREGEQVHGKVLADGYCSNVFVRTNLVNLYAMVGGGDGIGYARRVFDEMGERNV 186 Query: 274 V 276 V Sbjct: 187 V 187 >XP_006440636.1 hypothetical protein CICLE_v10019550mg [Citrus clementina] ESR53876.1 hypothetical protein CICLE_v10019550mg [Citrus clementina] Length = 556 Score = 96.7 bits (239), Expect = 3e-20 Identities = 45/62 (72%), Positives = 51/62 (82%) Frame = +1 Query: 91 MCARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRN 270 +CARCG FREGEQVHGRVLASGYCSNVF+R NL+NLY M GGE GV A +FD+M R+ Sbjct: 127 VCARCGFFREGEQVHGRVLASGYCSNVFMRTNLMNLYLMSGGECGVGCARLLFDDMPARS 186 Query: 271 VV 276 VV Sbjct: 187 VV 188 >XP_015883424.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ziziphus jujuba] XP_015883425.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ziziphus jujuba] Length = 552 Score = 95.9 bits (237), Expect = 6e-20 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CARCGL REGEQVHGRVL +GYCSN+F++ NL+NLYAM G +S + YA +VFDEM RNV Sbjct: 126 CARCGLLREGEQVHGRVLVNGYCSNMFVQTNLINLYAMAGVDSSITYARQVFDEMGQRNV 185 Query: 274 V 276 V Sbjct: 186 V 186 >XP_012080303.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Jatropha curcas] KDP31280.1 hypothetical protein JCGZ_11656 [Jatropha curcas] Length = 552 Score = 90.9 bits (224), Expect = 3e-18 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR GL REGEQVHGRVL +GY NVF++ NL+NLY M G + GV YA RVFDEM RN+ Sbjct: 127 CARSGLLREGEQVHGRVLVNGYYPNVFMKTNLINLYGMAGADFGVEYAQRVFDEMGERNI 186 Query: 274 VC 279 VC Sbjct: 187 VC 188 >CAN66661.1 hypothetical protein VITISV_031721, partial [Vitis vinifera] Length = 569 Score = 88.6 bits (218), Expect = 2e-17 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR L REGEQVHGRV+A+GYC+NVF+R +LVNLYA+ GG GV A RVFDE++ RN+ Sbjct: 142 CARSXLLREGEQVHGRVVANGYCTNVFVRTSLVNLYAIAGGYDGVRKARRVFDEIVDRNI 201 Query: 274 V 276 V Sbjct: 202 V 202 >CBI15196.3 unnamed protein product, partial [Vitis vinifera] Length = 467 Score = 88.2 bits (217), Expect = 2e-17 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR L REGEQVHGRV+A+GYC+NVF+R +LVNLYA+ GG GV A RVFDE++ RN+ Sbjct: 40 CARSRLLREGEQVHGRVVANGYCTNVFVRTSLVNLYAIAGGYDGVRKARRVFDEIVDRNI 99 Query: 274 V 276 V Sbjct: 100 V 100 >XP_010030169.2 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Eucalyptus grandis] Length = 470 Score = 88.2 bits (217), Expect = 2e-17 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 C R GLF EG QVHGRV+ GY +N F+R NLVNLYAMGGGESG+ A +VFDEM RN+ Sbjct: 41 CVRSGLFGEGLQVHGRVVRDGYAANPFVRANLVNLYAMGGGESGMEDARKVFDEMGERNL 100 Query: 274 VC 279 VC Sbjct: 101 VC 102 >XP_002281803.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 553 Score = 88.2 bits (217), Expect = 3e-17 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR L REGEQVHGRV+A+GYC+NVF+R +LVNLYA+ GG GV A RVFDE++ RN+ Sbjct: 126 CARSRLLREGEQVHGRVVANGYCTNVFVRTSLVNLYAIAGGYDGVRKARRVFDEIVDRNI 185 Query: 274 V 276 V Sbjct: 186 V 186 >OMO52853.1 hypothetical protein COLO4_36936 [Corchorus olitorius] Length = 447 Score = 86.7 bits (213), Expect = 8e-17 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR GL REG+QVHGRV G+CSNVF+R NL+NLYA+ G+ G+ +A +VFDEM RNV Sbjct: 20 CARSGLLREGKQVHGRVFVHGFCSNVFVRTNLINLYALVCGDDGIGFARKVFDEMGERNV 79 Query: 274 V 276 V Sbjct: 80 V 80 >XP_010089898.1 hypothetical protein L484_008586 [Morus notabilis] EXB38558.1 hypothetical protein L484_008586 [Morus notabilis] Length = 543 Score = 84.7 bits (208), Expect = 5e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 CAR GLFREGEQ+HG+VLA+GYCSNVF+ NLVNLYA+G G V A R FD++ +NV Sbjct: 114 CARSGLFREGEQIHGKVLANGYCSNVFVGSNLVNLYAVGEGGGLVECARRAFDDLREKNV 173 Query: 274 V 276 V Sbjct: 174 V 174 >XP_009339140.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 547 Score = 83.6 bits (205), Expect = 1e-15 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGE-SGVWYAHRVFDEMLVRN 270 CAR GL REGEQVHGRVL SG+ SNVF++ +LVNLYA GGG GV YA RVFD M R+ Sbjct: 126 CARSGLVREGEQVHGRVLGSGFVSNVFVQTSLVNLYATGGGSGGGVEYARRVFDGMRERS 185 Query: 271 VV 276 VV Sbjct: 186 VV 187 >XP_008374571.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Malus domestica] Length = 547 Score = 82.0 bits (201), Expect = 4e-15 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGES-GVWYAHRVFDEMLVRN 270 CAR GL REGEQVHGRVL SG+ SN+F++ +LVNLYA GGG + GV YA RVFD M R+ Sbjct: 126 CARSGLVREGEQVHGRVLGSGFDSNLFVQTSLVNLYATGGGSAGGVEYARRVFDGMRERS 185 Query: 271 VV 276 VV Sbjct: 186 VV 187 >XP_018826514.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] Length = 554 Score = 81.6 bits (200), Expect = 5e-15 Identities = 43/94 (45%), Positives = 61/94 (64%), Gaps = 2/94 (2%) Frame = +1 Query: 1 EAEEGRSKLEISTKKQAKSKHETSIKKQHVM--CARCGLFREGEQVHGRVLASGYCSNVF 174 +++ R +E+ + A +++ CAR L REGEQVHGRVLA+GYCSNVF Sbjct: 94 QSQTPRKSIELYNRMVAAEAEPDGFTYSYLLSACARAELLREGEQVHGRVLANGYCSNVF 153 Query: 175 IRINLVNLYAMGGGESGVWYAHRVFDEMLVRNVV 276 ++ NLVNLYAM G + + ++ RVF+EM R+VV Sbjct: 154 VQTNLVNLYAM-SGVNDISHSRRVFEEMSDRSVV 186 >XP_017637874.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium arboreum] Length = 554 Score = 80.5 bits (197), Expect = 1e-14 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 C R G+ REGEQ+HGRVL GY SNVF+R NL+NLY M G G+ +A ++FDEM RN Sbjct: 127 CTRSGMLREGEQIHGRVLVDGYFSNVFVRTNLINLYGMVGVGDGIVHARKLFDEMAERNA 186 Query: 274 V 276 V Sbjct: 187 V 187 >XP_016741753.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium hirsutum] Length = 554 Score = 80.5 bits (197), Expect = 1e-14 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGESGVWYAHRVFDEMLVRNV 273 C R G+ REGEQ+HGRVL GY SNVF+R NL+NLY M G G+ +A ++FDEM RN Sbjct: 127 CTRSGMLREGEQIHGRVLVDGYFSNVFVRTNLINLYGMVGVGDGIVHARKLFDEMAERNA 186 Query: 274 V 276 V Sbjct: 187 V 187 >XP_008239983.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 556 Score = 80.1 bits (196), Expect = 2e-14 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = +1 Query: 94 CARCGLFREGEQVHGRVLASGYCSNVFIRINLVNLYAMGGGES-GVWYAHRVFDEMLVRN 270 CAR GL REGEQVH RVLA+G+ SNVF++ +LVNLYA+ GG GV YA RVFD+M R+ Sbjct: 127 CARSGLVREGEQVHARVLANGFDSNVFVQTSLVNLYAISGGSGCGVEYARRVFDDMGERS 186 Query: 271 VV 276 VV Sbjct: 187 VV 188